Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9NDB0

Protein Details
Accession G9NDB0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
35-69AGPPAVKSRKDLPKKTKKTYKKKQNIVPVKKPGPGHydrophilic
NLS Segment(s)
PositionSequence
40-77VKSRKDLPKKTKKTYKKKQNIVPVKKPGPGERKAFRKR
Subcellular Location(s) mito 25.5, cyto_mito 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR019368  Ribosomal_S23/S29_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF10236  DAP3  
Amino Acid Sequences MASLSLRTLVRPAIPVAPRIQPLIAAFSTTSLLAAGPPAVKSRKDLPKKTKKTYKKKQNIVPVKKPGPGERKAFRKRIQLSNNSALPVTGIESLEAQTMAREESGGKMFAVPDQVVDQLRALEAFKTTQTWNLFRKPHVLVRKETVELMSKLDASVEKKEAFKCLGQDLTNGNTEFSPVPDTEPMQFTQPVYCLKLIQNIYKANKAVLEKTPLKMDWSRLTGLKQGATLADLALSAKESEFAWPTLSALWTELTQPGQPPVLLTLDGLAHINKVSAYRDPSFNIVHAHELLLVRTFVDALSGKTKLPNGGAVIAATSENNTHYHPSQELVLSQLEAGQAGREVPKPNAYEKKYDDRVYDALKNSQVIRLEGVSKDEARVLMEYWGASGMLRRALDSKAVAEKWALGGHGIVGEMERASLMTMRM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.31
3 0.32
4 0.35
5 0.35
6 0.35
7 0.32
8 0.26
9 0.26
10 0.28
11 0.24
12 0.2
13 0.18
14 0.17
15 0.18
16 0.15
17 0.14
18 0.08
19 0.08
20 0.07
21 0.08
22 0.08
23 0.09
24 0.1
25 0.16
26 0.19
27 0.2
28 0.24
29 0.33
30 0.42
31 0.52
32 0.61
33 0.67
34 0.74
35 0.84
36 0.9
37 0.91
38 0.92
39 0.93
40 0.93
41 0.94
42 0.93
43 0.93
44 0.91
45 0.91
46 0.92
47 0.91
48 0.89
49 0.88
50 0.82
51 0.77
52 0.72
53 0.7
54 0.67
55 0.64
56 0.62
57 0.6
58 0.66
59 0.7
60 0.75
61 0.72
62 0.74
63 0.75
64 0.77
65 0.78
66 0.77
67 0.76
68 0.75
69 0.7
70 0.61
71 0.53
72 0.43
73 0.33
74 0.24
75 0.18
76 0.12
77 0.09
78 0.09
79 0.1
80 0.1
81 0.1
82 0.1
83 0.08
84 0.07
85 0.07
86 0.07
87 0.06
88 0.06
89 0.06
90 0.09
91 0.12
92 0.12
93 0.11
94 0.12
95 0.12
96 0.13
97 0.15
98 0.11
99 0.1
100 0.11
101 0.13
102 0.13
103 0.13
104 0.12
105 0.1
106 0.1
107 0.1
108 0.09
109 0.08
110 0.08
111 0.09
112 0.09
113 0.11
114 0.11
115 0.17
116 0.2
117 0.25
118 0.29
119 0.35
120 0.38
121 0.37
122 0.42
123 0.4
124 0.44
125 0.48
126 0.47
127 0.43
128 0.45
129 0.48
130 0.43
131 0.39
132 0.33
133 0.29
134 0.25
135 0.24
136 0.19
137 0.15
138 0.14
139 0.15
140 0.15
141 0.13
142 0.15
143 0.17
144 0.18
145 0.21
146 0.21
147 0.23
148 0.23
149 0.22
150 0.21
151 0.2
152 0.22
153 0.19
154 0.21
155 0.2
156 0.2
157 0.22
158 0.2
159 0.17
160 0.14
161 0.15
162 0.13
163 0.12
164 0.12
165 0.09
166 0.1
167 0.11
168 0.12
169 0.12
170 0.14
171 0.14
172 0.14
173 0.14
174 0.13
175 0.13
176 0.14
177 0.14
178 0.14
179 0.14
180 0.14
181 0.13
182 0.2
183 0.21
184 0.21
185 0.24
186 0.28
187 0.29
188 0.31
189 0.3
190 0.24
191 0.25
192 0.24
193 0.22
194 0.19
195 0.24
196 0.23
197 0.23
198 0.25
199 0.22
200 0.24
201 0.23
202 0.24
203 0.21
204 0.21
205 0.22
206 0.21
207 0.22
208 0.23
209 0.22
210 0.2
211 0.16
212 0.14
213 0.13
214 0.12
215 0.11
216 0.06
217 0.05
218 0.04
219 0.04
220 0.04
221 0.04
222 0.04
223 0.04
224 0.04
225 0.05
226 0.06
227 0.07
228 0.08
229 0.09
230 0.09
231 0.09
232 0.09
233 0.09
234 0.08
235 0.07
236 0.07
237 0.07
238 0.08
239 0.08
240 0.09
241 0.09
242 0.09
243 0.1
244 0.1
245 0.1
246 0.09
247 0.09
248 0.09
249 0.09
250 0.08
251 0.07
252 0.07
253 0.07
254 0.08
255 0.06
256 0.06
257 0.06
258 0.06
259 0.05
260 0.07
261 0.08
262 0.1
263 0.15
264 0.17
265 0.19
266 0.2
267 0.23
268 0.23
269 0.22
270 0.22
271 0.18
272 0.18
273 0.16
274 0.15
275 0.14
276 0.14
277 0.13
278 0.11
279 0.1
280 0.09
281 0.08
282 0.08
283 0.05
284 0.08
285 0.08
286 0.09
287 0.12
288 0.13
289 0.13
290 0.16
291 0.17
292 0.17
293 0.17
294 0.18
295 0.16
296 0.16
297 0.16
298 0.14
299 0.12
300 0.11
301 0.1
302 0.08
303 0.07
304 0.06
305 0.07
306 0.09
307 0.1
308 0.13
309 0.14
310 0.16
311 0.17
312 0.17
313 0.18
314 0.18
315 0.17
316 0.15
317 0.15
318 0.13
319 0.12
320 0.12
321 0.09
322 0.09
323 0.08
324 0.06
325 0.06
326 0.07
327 0.1
328 0.13
329 0.15
330 0.18
331 0.24
332 0.26
333 0.34
334 0.42
335 0.43
336 0.47
337 0.5
338 0.58
339 0.59
340 0.6
341 0.54
342 0.5
343 0.51
344 0.48
345 0.49
346 0.42
347 0.4
348 0.38
349 0.39
350 0.35
351 0.34
352 0.31
353 0.26
354 0.25
355 0.22
356 0.23
357 0.21
358 0.24
359 0.23
360 0.22
361 0.22
362 0.21
363 0.2
364 0.18
365 0.19
366 0.16
367 0.14
368 0.14
369 0.13
370 0.12
371 0.12
372 0.1
373 0.09
374 0.11
375 0.11
376 0.15
377 0.15
378 0.16
379 0.18
380 0.19
381 0.23
382 0.22
383 0.24
384 0.27
385 0.27
386 0.27
387 0.25
388 0.25
389 0.24
390 0.23
391 0.19
392 0.12
393 0.12
394 0.11
395 0.11
396 0.1
397 0.08
398 0.07
399 0.08
400 0.07
401 0.07
402 0.06
403 0.06
404 0.07