Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7PKG7

Protein Details
Accession A0A4Y7PKG7    Localization Confidence Low Confidence Score 6.3
NoLS Segment(s)
PositionSequenceProtein Nature
99-118YPAQRLKRTCHSLRRARYKFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, plas 5, nucl 4, cyto 4, cyto_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001197  Ribosomal_L10e  
IPR036920  Ribosomal_L10e/L16_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Amino Acid Sequences MFPIPWSVVFLSGESAPHSISYSAATSCWMNVSSCQPRRSRLRAAHVCANKYVTNIAGKHAFHLRMKMHPNRPYLSIQFYSADSYARAPGKPDGAVALYPAQRLKRTCHSLRRARYKFPGRQDTVISGKRGFMSVDRDEY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.11
4 0.11
5 0.12
6 0.1
7 0.1
8 0.11
9 0.11
10 0.11
11 0.11
12 0.12
13 0.11
14 0.11
15 0.12
16 0.11
17 0.1
18 0.12
19 0.2
20 0.28
21 0.34
22 0.4
23 0.41
24 0.47
25 0.54
26 0.59
27 0.6
28 0.57
29 0.62
30 0.64
31 0.67
32 0.69
33 0.65
34 0.6
35 0.52
36 0.48
37 0.37
38 0.3
39 0.25
40 0.18
41 0.18
42 0.17
43 0.17
44 0.18
45 0.18
46 0.19
47 0.22
48 0.23
49 0.19
50 0.24
51 0.23
52 0.25
53 0.32
54 0.38
55 0.42
56 0.45
57 0.48
58 0.44
59 0.46
60 0.43
61 0.38
62 0.35
63 0.28
64 0.24
65 0.21
66 0.2
67 0.19
68 0.16
69 0.14
70 0.1
71 0.1
72 0.13
73 0.13
74 0.13
75 0.13
76 0.15
77 0.16
78 0.16
79 0.15
80 0.13
81 0.12
82 0.12
83 0.11
84 0.14
85 0.12
86 0.13
87 0.16
88 0.17
89 0.2
90 0.22
91 0.27
92 0.32
93 0.41
94 0.48
95 0.55
96 0.63
97 0.69
98 0.77
99 0.83
100 0.78
101 0.77
102 0.79
103 0.79
104 0.77
105 0.78
106 0.78
107 0.72
108 0.7
109 0.66
110 0.62
111 0.6
112 0.57
113 0.5
114 0.4
115 0.37
116 0.34
117 0.32
118 0.27
119 0.23
120 0.25