Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7PG76

Protein Details
Accession A0A4Y7PG76    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
35-65HVVTVHTRLRPRRPRPRRRRRSAPATKANADBasic
NLS Segment(s)
PositionSequence
42-58RLRPRRPRPRRRRRSAP
Subcellular Location(s) nucl 15, cyto_nucl 11.5, cyto 6, mito 4
Family & Domain DBs
Amino Acid Sequences MQPVIADDKTSSFCFNHNPNPGNPSATGKNRLERHVVTVHTRLRPRRPRPRRRRRSAPATKANADECPHQDRYGPQSKHPGTSANSDVKALGQPVTAVGVMRQPRTHPPLAVHTTPDAGIGAGLAGRTERPRAEAGRADASESEAKRHAAGWKGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.32
3 0.38
4 0.43
5 0.45
6 0.44
7 0.48
8 0.48
9 0.43
10 0.38
11 0.35
12 0.34
13 0.36
14 0.41
15 0.4
16 0.47
17 0.48
18 0.5
19 0.49
20 0.43
21 0.43
22 0.4
23 0.39
24 0.36
25 0.39
26 0.41
27 0.42
28 0.47
29 0.48
30 0.54
31 0.62
32 0.68
33 0.72
34 0.78
35 0.83
36 0.89
37 0.94
38 0.94
39 0.94
40 0.95
41 0.93
42 0.93
43 0.93
44 0.91
45 0.89
46 0.84
47 0.76
48 0.67
49 0.59
50 0.5
51 0.4
52 0.33
53 0.27
54 0.26
55 0.25
56 0.22
57 0.22
58 0.21
59 0.27
60 0.34
61 0.32
62 0.29
63 0.37
64 0.38
65 0.39
66 0.37
67 0.34
68 0.26
69 0.29
70 0.31
71 0.24
72 0.24
73 0.22
74 0.22
75 0.18
76 0.17
77 0.14
78 0.1
79 0.06
80 0.06
81 0.06
82 0.07
83 0.06
84 0.06
85 0.05
86 0.1
87 0.12
88 0.13
89 0.14
90 0.15
91 0.22
92 0.28
93 0.3
94 0.27
95 0.28
96 0.35
97 0.4
98 0.39
99 0.34
100 0.29
101 0.28
102 0.26
103 0.23
104 0.15
105 0.09
106 0.08
107 0.06
108 0.05
109 0.04
110 0.04
111 0.04
112 0.04
113 0.06
114 0.08
115 0.11
116 0.12
117 0.14
118 0.19
119 0.22
120 0.27
121 0.31
122 0.34
123 0.39
124 0.38
125 0.37
126 0.33
127 0.34
128 0.35
129 0.3
130 0.29
131 0.24
132 0.25
133 0.24
134 0.26
135 0.28