Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7Q3B8

Protein Details
Accession A0A4Y7Q3B8    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
11-37IQSCLHCHTNKRKCDRKRPCQRCIQLGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 11, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences DHRTRRRVRAIQSCLHCHTNKRKCDRKRPCQRCIQLGMTGLCIYEADDPDARHDPNVAETTKLQNRIAELEILVRELR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.65
3 0.58
4 0.55
5 0.59
6 0.59
7 0.61
8 0.65
9 0.7
10 0.74
11 0.83
12 0.86
13 0.86
14 0.89
15 0.89
16 0.87
17 0.88
18 0.83
19 0.78
20 0.72
21 0.64
22 0.55
23 0.49
24 0.41
25 0.32
26 0.26
27 0.19
28 0.13
29 0.1
30 0.08
31 0.07
32 0.07
33 0.08
34 0.1
35 0.1
36 0.14
37 0.17
38 0.16
39 0.15
40 0.16
41 0.14
42 0.16
43 0.2
44 0.17
45 0.16
46 0.18
47 0.25
48 0.3
49 0.33
50 0.3
51 0.28
52 0.3
53 0.31
54 0.31
55 0.24
56 0.2
57 0.19
58 0.18