Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y7PWY0

Protein Details
Accession A0A4Y7PWY0    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MKSVRRLAKRRNDTFGKRHIGBasic
NLS Segment(s)
Subcellular Location(s) nucl 12, cyto_nucl 9.5, mito 9, cyto 5
Family & Domain DBs
Amino Acid Sequences MKSVRRLAKRRNDTFGKRHIGRRDLGETRRDLCNLRNYAPPIALGEQGDALSGHNTTLMDCSVRGWVNTCIYSFSGTSWKGPRLERIMAIRHASDGGRHSTKLIVVNCGHRPLRCTPSVDVRVRASNIASVYGASPTTNLLSLGTARKDPIKCPFQHTESTSCRTSGCDCCSMFIKCGPKPYYRHRLSRNAIPRLGRNRKQTDMKVVIGQKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.8
3 0.79
4 0.74
5 0.75
6 0.74
7 0.69
8 0.64
9 0.62
10 0.61
11 0.59
12 0.58
13 0.56
14 0.51
15 0.49
16 0.49
17 0.44
18 0.38
19 0.36
20 0.4
21 0.39
22 0.38
23 0.41
24 0.41
25 0.41
26 0.39
27 0.34
28 0.28
29 0.25
30 0.24
31 0.17
32 0.15
33 0.13
34 0.12
35 0.12
36 0.09
37 0.08
38 0.07
39 0.07
40 0.06
41 0.06
42 0.07
43 0.07
44 0.08
45 0.08
46 0.07
47 0.07
48 0.08
49 0.11
50 0.11
51 0.11
52 0.13
53 0.15
54 0.17
55 0.18
56 0.17
57 0.16
58 0.16
59 0.17
60 0.15
61 0.13
62 0.15
63 0.15
64 0.18
65 0.2
66 0.23
67 0.25
68 0.25
69 0.29
70 0.29
71 0.3
72 0.3
73 0.31
74 0.31
75 0.3
76 0.3
77 0.25
78 0.2
79 0.2
80 0.17
81 0.14
82 0.12
83 0.15
84 0.15
85 0.14
86 0.15
87 0.14
88 0.16
89 0.2
90 0.18
91 0.17
92 0.17
93 0.21
94 0.22
95 0.26
96 0.25
97 0.2
98 0.23
99 0.24
100 0.28
101 0.26
102 0.28
103 0.25
104 0.33
105 0.41
106 0.39
107 0.37
108 0.34
109 0.35
110 0.32
111 0.31
112 0.22
113 0.17
114 0.15
115 0.13
116 0.11
117 0.09
118 0.09
119 0.08
120 0.08
121 0.06
122 0.06
123 0.06
124 0.06
125 0.06
126 0.06
127 0.06
128 0.06
129 0.08
130 0.11
131 0.12
132 0.12
133 0.13
134 0.19
135 0.2
136 0.22
137 0.29
138 0.34
139 0.35
140 0.41
141 0.47
142 0.44
143 0.49
144 0.49
145 0.49
146 0.46
147 0.49
148 0.43
149 0.37
150 0.34
151 0.3
152 0.32
153 0.3
154 0.29
155 0.3
156 0.29
157 0.31
158 0.35
159 0.34
160 0.32
161 0.3
162 0.34
163 0.3
164 0.39
165 0.41
166 0.43
167 0.49
168 0.57
169 0.62
170 0.62
171 0.7
172 0.69
173 0.75
174 0.75
175 0.78
176 0.78
177 0.75
178 0.72
179 0.67
180 0.68
181 0.68
182 0.73
183 0.7
184 0.7
185 0.7
186 0.74
187 0.78
188 0.76
189 0.75
190 0.71
191 0.66
192 0.64