Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7PD84

Protein Details
Accession A0A4Y7PD84    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
52-82QTDKLKRQQRSEEEKKKKKKKAEEEESDTEABasic
NLS Segment(s)
PositionSequence
57-72KRQQRSEEEKKKKKKK
Subcellular Location(s) nucl 16, mito 6, cyto 4
Family & Domain DBs
Amino Acid Sequences HYKRAFNTQACEQLNAWIGGFQTVLNKMTIGNFDWSLHALLFIHTQRVIKAQTDKLKRQQRSEEEKKKKKKKAEEEESDTEAEGFDIDRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.32
3 0.25
4 0.17
5 0.16
6 0.13
7 0.13
8 0.1
9 0.09
10 0.11
11 0.11
12 0.1
13 0.1
14 0.1
15 0.11
16 0.12
17 0.11
18 0.12
19 0.12
20 0.12
21 0.12
22 0.13
23 0.12
24 0.11
25 0.09
26 0.07
27 0.07
28 0.09
29 0.09
30 0.09
31 0.09
32 0.1
33 0.1
34 0.12
35 0.13
36 0.12
37 0.17
38 0.22
39 0.29
40 0.36
41 0.41
42 0.49
43 0.57
44 0.58
45 0.6
46 0.64
47 0.65
48 0.69
49 0.75
50 0.76
51 0.78
52 0.84
53 0.89
54 0.9
55 0.89
56 0.89
57 0.89
58 0.89
59 0.89
60 0.89
61 0.88
62 0.86
63 0.83
64 0.76
65 0.66
66 0.55
67 0.43
68 0.32
69 0.22
70 0.14