Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y7PUD3

Protein Details
Accession A0A4Y7PUD3    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
5-24VSNWVQSKRRREVRENDEINHydrophilic
NLS Segment(s)
PositionSequence
79-115RPRGKGNKPSSGPKSPTKPPSPTKPKPASGDSKPRPK
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MKGNVSNWVQSKRRREVRENDEINESKGIAAADDLISGPDHGGSEAGTPSVDSDELVEQSASQSPLNIPTNEEEESEWRPRGKGNKPSSGPKSPTKPPSPTKPKPASGDSKPRPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.75
3 0.77
4 0.79
5 0.81
6 0.76
7 0.67
8 0.66
9 0.59
10 0.52
11 0.42
12 0.33
13 0.22
14 0.2
15 0.17
16 0.09
17 0.08
18 0.07
19 0.06
20 0.06
21 0.06
22 0.05
23 0.06
24 0.06
25 0.05
26 0.05
27 0.05
28 0.04
29 0.05
30 0.04
31 0.05
32 0.05
33 0.05
34 0.05
35 0.05
36 0.05
37 0.05
38 0.05
39 0.04
40 0.05
41 0.06
42 0.06
43 0.06
44 0.06
45 0.05
46 0.06
47 0.07
48 0.08
49 0.07
50 0.07
51 0.07
52 0.13
53 0.15
54 0.15
55 0.15
56 0.15
57 0.18
58 0.18
59 0.19
60 0.14
61 0.14
62 0.18
63 0.21
64 0.21
65 0.19
66 0.19
67 0.23
68 0.3
69 0.37
70 0.43
71 0.47
72 0.55
73 0.58
74 0.67
75 0.7
76 0.71
77 0.67
78 0.65
79 0.64
80 0.63
81 0.68
82 0.66
83 0.67
84 0.66
85 0.73
86 0.75
87 0.77
88 0.79
89 0.78
90 0.78
91 0.76
92 0.76
93 0.74
94 0.72
95 0.75