Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G9MPV9

Protein Details
Accession G9MPV9    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
174-199VPSFPAYKKENKRKRAARAKAAKAEEHydrophilic
NLS Segment(s)
PositionSequence
181-197KKENKRKRAARAKAAKA
217-226GGKSKGKKGK
Subcellular Location(s) nucl 19.5, cyto_nucl 13.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001623  DnaJ_domain  
IPR018253  DnaJ_domain_CS  
IPR036869  J_dom_sf  
Pfam View protein in Pfam  
PF00226  DnaJ  
PROSITE View protein in PROSITE  
PS00636  DNAJ_1  
PS50076  DNAJ_2  
CDD cd06257  DnaJ  
Amino Acid Sequences MSDHEDVVDGEPPAIDPYEVLGLERTATADQVKSAYRKAALKNHPDKVPESQKEEAHETFQSIAFAYAVLSDPARRKRYDTTGSTSESIVDSEGFDWSEYYREQYKDAISEDAIRKFAEKYKRSDEEKDDLLIAYEECEGDMDQVYERVMLSDVVEDDERFRKIIDEAIETGDVPSFPAYKKENKRKRAARAKAAKAEEAEAEELAKELGVHDKIFGGKSKGKKGKGSSEDDLAALIQKRQKDRAGDFFKRCRQEGQRKEACCGRRRRGAIRGGVSSRGSET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.1
3 0.07
4 0.09
5 0.12
6 0.12
7 0.12
8 0.12
9 0.11
10 0.12
11 0.12
12 0.12
13 0.09
14 0.1
15 0.12
16 0.11
17 0.12
18 0.14
19 0.18
20 0.19
21 0.21
22 0.24
23 0.26
24 0.32
25 0.38
26 0.45
27 0.5
28 0.58
29 0.65
30 0.68
31 0.68
32 0.64
33 0.6
34 0.6
35 0.62
36 0.56
37 0.53
38 0.51
39 0.49
40 0.51
41 0.53
42 0.45
43 0.37
44 0.33
45 0.28
46 0.24
47 0.23
48 0.19
49 0.13
50 0.13
51 0.09
52 0.09
53 0.07
54 0.06
55 0.06
56 0.07
57 0.07
58 0.09
59 0.16
60 0.24
61 0.29
62 0.29
63 0.32
64 0.38
65 0.47
66 0.52
67 0.5
68 0.49
69 0.49
70 0.51
71 0.49
72 0.42
73 0.34
74 0.26
75 0.21
76 0.14
77 0.1
78 0.07
79 0.07
80 0.07
81 0.07
82 0.06
83 0.06
84 0.06
85 0.08
86 0.08
87 0.1
88 0.14
89 0.15
90 0.16
91 0.18
92 0.18
93 0.19
94 0.2
95 0.18
96 0.14
97 0.19
98 0.2
99 0.2
100 0.2
101 0.18
102 0.17
103 0.18
104 0.23
105 0.27
106 0.28
107 0.32
108 0.39
109 0.46
110 0.49
111 0.53
112 0.52
113 0.47
114 0.44
115 0.39
116 0.32
117 0.25
118 0.21
119 0.16
120 0.11
121 0.07
122 0.06
123 0.05
124 0.04
125 0.05
126 0.04
127 0.05
128 0.05
129 0.04
130 0.04
131 0.05
132 0.05
133 0.05
134 0.04
135 0.04
136 0.05
137 0.04
138 0.05
139 0.05
140 0.05
141 0.06
142 0.06
143 0.06
144 0.08
145 0.1
146 0.1
147 0.1
148 0.1
149 0.1
150 0.1
151 0.14
152 0.13
153 0.13
154 0.14
155 0.15
156 0.15
157 0.14
158 0.14
159 0.11
160 0.09
161 0.07
162 0.07
163 0.06
164 0.06
165 0.11
166 0.14
167 0.24
168 0.34
169 0.45
170 0.54
171 0.62
172 0.72
173 0.75
174 0.83
175 0.85
176 0.83
177 0.83
178 0.83
179 0.83
180 0.8
181 0.74
182 0.65
183 0.55
184 0.48
185 0.38
186 0.3
187 0.23
188 0.14
189 0.12
190 0.1
191 0.09
192 0.07
193 0.06
194 0.04
195 0.04
196 0.09
197 0.1
198 0.1
199 0.1
200 0.12
201 0.13
202 0.15
203 0.17
204 0.18
205 0.23
206 0.29
207 0.39
208 0.46
209 0.5
210 0.56
211 0.59
212 0.64
213 0.66
214 0.68
215 0.6
216 0.56
217 0.52
218 0.45
219 0.39
220 0.28
221 0.24
222 0.17
223 0.18
224 0.17
225 0.21
226 0.25
227 0.3
228 0.36
229 0.4
230 0.45
231 0.52
232 0.59
233 0.63
234 0.67
235 0.71
236 0.75
237 0.73
238 0.69
239 0.67
240 0.68
241 0.7
242 0.72
243 0.73
244 0.73
245 0.69
246 0.73
247 0.71
248 0.68
249 0.66
250 0.67
251 0.65
252 0.66
253 0.71
254 0.73
255 0.75
256 0.75
257 0.75
258 0.71
259 0.71
260 0.64
261 0.62
262 0.55