Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LZ34

Protein Details
Accession E2LZ34   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
65-84IPDEQPKARPRRFFRPRIHPBasic
NLS Segment(s)
PositionSequence
73-79RPRRFFR
Subcellular Location(s) plas 15, extr 5, E.R. 4, golg 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG mpr:MPER_12598  -  
Amino Acid Sequences MQSLFCQGIWHHTMQRVSITAIFIFLISLLVVSALVPLERSSLSSSIPDGADKDSTLSSQGRDAIPDEQPKARPRRFFRPRIHP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.31
3 0.25
4 0.24
5 0.22
6 0.2
7 0.15
8 0.14
9 0.13
10 0.1
11 0.09
12 0.07
13 0.05
14 0.04
15 0.04
16 0.03
17 0.03
18 0.03
19 0.03
20 0.03
21 0.03
22 0.03
23 0.03
24 0.03
25 0.04
26 0.04
27 0.06
28 0.07
29 0.08
30 0.08
31 0.08
32 0.09
33 0.09
34 0.1
35 0.09
36 0.08
37 0.09
38 0.09
39 0.09
40 0.1
41 0.09
42 0.09
43 0.11
44 0.11
45 0.1
46 0.12
47 0.15
48 0.13
49 0.14
50 0.16
51 0.17
52 0.21
53 0.25
54 0.27
55 0.28
56 0.34
57 0.41
58 0.49
59 0.52
60 0.57
61 0.6
62 0.68
63 0.74
64 0.79