Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7PRI7

Protein Details
Accession A0A4Y7PRI7    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
254-281LKEDIRKLEKDEKKIRKKIQNERSSFCLHydrophilic
NLS Segment(s)
PositionSequence
251-271RRSLKEDIRKLEKDEKKIRKK
Subcellular Location(s) nucl 18, cyto_nucl 13.833, mito_nucl 10.999, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006073  GTP-bd  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0005525  F:GTP binding  
GO:0016787  F:hydrolase activity  
Pfam View protein in Pfam  
PF01926  MMR_HSR1  
CDD cd00882  Ras_like_GTPase  
Amino Acid Sequences MTPTSDVQPTLIAVVGHTGAGKSSFINTVSNHKLPVGAGLDSCTKKIQEVRLKWGKEQKPVVIVDTPGFGDSDNLEVTRDIEVFKLIQSYLVKSHKAGTKLSGIIYTHRISDSKVEGGTRRNLRTFQELCGSEKLHRVVILTTWWDKEEEAKAVSREKQLSGRETLFKPMVELGAKMMRHDKGFSSAQMVLNHLLQLNAVDLGIQEKPVRDETPEDGLDINLDLQDKLRHCLDSVAAKKGELKNARDDATRRSLKEDIRKLEKDEKKIRKKIQNERSSFCLVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.09
4 0.09
5 0.08
6 0.07
7 0.09
8 0.09
9 0.08
10 0.1
11 0.12
12 0.13
13 0.16
14 0.17
15 0.25
16 0.31
17 0.32
18 0.31
19 0.29
20 0.29
21 0.25
22 0.29
23 0.23
24 0.17
25 0.15
26 0.17
27 0.23
28 0.23
29 0.24
30 0.21
31 0.19
32 0.22
33 0.27
34 0.34
35 0.38
36 0.42
37 0.51
38 0.58
39 0.6
40 0.63
41 0.68
42 0.64
43 0.62
44 0.62
45 0.55
46 0.52
47 0.51
48 0.47
49 0.39
50 0.35
51 0.27
52 0.23
53 0.2
54 0.14
55 0.13
56 0.1
57 0.08
58 0.08
59 0.09
60 0.08
61 0.08
62 0.08
63 0.08
64 0.09
65 0.1
66 0.1
67 0.08
68 0.08
69 0.09
70 0.08
71 0.09
72 0.09
73 0.08
74 0.11
75 0.11
76 0.13
77 0.18
78 0.22
79 0.22
80 0.21
81 0.27
82 0.27
83 0.29
84 0.28
85 0.24
86 0.25
87 0.26
88 0.26
89 0.23
90 0.19
91 0.19
92 0.22
93 0.2
94 0.16
95 0.16
96 0.16
97 0.14
98 0.17
99 0.17
100 0.15
101 0.15
102 0.15
103 0.17
104 0.2
105 0.26
106 0.28
107 0.29
108 0.29
109 0.3
110 0.31
111 0.37
112 0.35
113 0.3
114 0.3
115 0.29
116 0.29
117 0.3
118 0.29
119 0.22
120 0.24
121 0.23
122 0.18
123 0.17
124 0.15
125 0.13
126 0.12
127 0.12
128 0.1
129 0.1
130 0.1
131 0.11
132 0.1
133 0.1
134 0.12
135 0.12
136 0.12
137 0.12
138 0.13
139 0.14
140 0.16
141 0.19
142 0.2
143 0.2
144 0.2
145 0.25
146 0.26
147 0.28
148 0.28
149 0.28
150 0.28
151 0.28
152 0.3
153 0.26
154 0.23
155 0.21
156 0.17
157 0.17
158 0.13
159 0.12
160 0.1
161 0.14
162 0.14
163 0.14
164 0.17
165 0.17
166 0.18
167 0.19
168 0.17
169 0.18
170 0.2
171 0.2
172 0.2
173 0.21
174 0.24
175 0.24
176 0.24
177 0.2
178 0.19
179 0.19
180 0.15
181 0.12
182 0.08
183 0.07
184 0.06
185 0.05
186 0.05
187 0.04
188 0.04
189 0.06
190 0.06
191 0.07
192 0.08
193 0.08
194 0.11
195 0.14
196 0.15
197 0.14
198 0.18
199 0.2
200 0.25
201 0.24
202 0.23
203 0.2
204 0.19
205 0.18
206 0.15
207 0.12
208 0.07
209 0.07
210 0.07
211 0.08
212 0.13
213 0.14
214 0.17
215 0.18
216 0.18
217 0.18
218 0.2
219 0.22
220 0.27
221 0.3
222 0.33
223 0.32
224 0.31
225 0.38
226 0.39
227 0.45
228 0.42
229 0.42
230 0.44
231 0.49
232 0.51
233 0.49
234 0.48
235 0.46
236 0.49
237 0.52
238 0.44
239 0.45
240 0.48
241 0.51
242 0.59
243 0.61
244 0.6
245 0.63
246 0.65
247 0.66
248 0.71
249 0.71
250 0.71
251 0.72
252 0.75
253 0.76
254 0.83
255 0.87
256 0.86
257 0.89
258 0.9
259 0.9
260 0.9
261 0.86
262 0.81
263 0.77