Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7QD69

Protein Details
Accession A0A4Y7QD69    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
9-34TQPATEGGEKKKRRKVRKETYSSYIYHydrophilic
NLS Segment(s)
PositionSequence
15-26GGEKKKRRKVRK
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR007125  Histone_H2A/H2B/H3  
IPR000558  Histone_H2B  
Gene Ontology GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
Pfam View protein in Pfam  
PF00125  Histone  
PROSITE View protein in PROSITE  
PS00357  HISTONE_H2B  
Amino Acid Sequences MAPKTSKKTQPATEGGEKKKRRKVRKETYSSYIYKVLKQVHPDTGISNKAMAILNSFVNDIFERIATEASKLASYSKKSTISSREIQTSVRLILPGELSKHAISEGTKSVTKFSAGAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.69
3 0.71
4 0.72
5 0.73
6 0.77
7 0.79
8 0.8
9 0.82
10 0.85
11 0.87
12 0.9
13 0.9
14 0.87
15 0.83
16 0.79
17 0.7
18 0.62
19 0.58
20 0.48
21 0.4
22 0.39
23 0.38
24 0.34
25 0.38
26 0.38
27 0.35
28 0.35
29 0.34
30 0.3
31 0.28
32 0.26
33 0.21
34 0.18
35 0.14
36 0.14
37 0.13
38 0.11
39 0.09
40 0.09
41 0.09
42 0.09
43 0.09
44 0.07
45 0.07
46 0.08
47 0.07
48 0.06
49 0.05
50 0.05
51 0.06
52 0.07
53 0.06
54 0.06
55 0.07
56 0.07
57 0.07
58 0.07
59 0.09
60 0.12
61 0.15
62 0.18
63 0.22
64 0.25
65 0.27
66 0.31
67 0.35
68 0.37
69 0.4
70 0.4
71 0.4
72 0.37
73 0.36
74 0.34
75 0.3
76 0.26
77 0.2
78 0.18
79 0.14
80 0.14
81 0.16
82 0.15
83 0.15
84 0.15
85 0.17
86 0.17
87 0.17
88 0.15
89 0.15
90 0.14
91 0.16
92 0.18
93 0.2
94 0.23
95 0.23
96 0.25
97 0.25
98 0.25