Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7QBK1

Protein Details
Accession A0A4Y7QBK1    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
13-40FSLALSKELNRQKPRKRRATTHRRTGSVHydrophilic
NLS Segment(s)
PositionSequence
23-32RQKPRKRRAT
Subcellular Location(s) nucl 14.5, cyto_nucl 9.5, mito 8, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MGRSPSDHVYPSFSLALSKELNRQKPRKRRATTHRRTGSVPAAEWGRSHSITVTEKLQGYRWRAGRRRLSWLGWRVTSLLQMGQLNRNATCLRTPNSSFSETRKVGTSESKKACCAISGTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.19
3 0.22
4 0.19
5 0.2
6 0.25
7 0.32
8 0.41
9 0.49
10 0.58
11 0.65
12 0.73
13 0.81
14 0.84
15 0.84
16 0.85
17 0.87
18 0.89
19 0.89
20 0.89
21 0.86
22 0.77
23 0.72
24 0.66
25 0.62
26 0.52
27 0.42
28 0.34
29 0.28
30 0.26
31 0.23
32 0.2
33 0.17
34 0.14
35 0.14
36 0.12
37 0.14
38 0.16
39 0.17
40 0.16
41 0.15
42 0.16
43 0.17
44 0.2
45 0.21
46 0.23
47 0.27
48 0.3
49 0.37
50 0.41
51 0.49
52 0.55
53 0.53
54 0.58
55 0.56
56 0.54
57 0.53
58 0.54
59 0.49
60 0.41
61 0.38
62 0.31
63 0.28
64 0.25
65 0.18
66 0.13
67 0.11
68 0.13
69 0.14
70 0.16
71 0.19
72 0.19
73 0.19
74 0.21
75 0.19
76 0.19
77 0.21
78 0.22
79 0.22
80 0.27
81 0.29
82 0.32
83 0.36
84 0.39
85 0.37
86 0.38
87 0.44
88 0.39
89 0.38
90 0.36
91 0.33
92 0.32
93 0.41
94 0.42
95 0.43
96 0.5
97 0.51
98 0.49
99 0.5
100 0.47
101 0.39