Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7QDT6

Protein Details
Accession A0A4Y7QDT6    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-33MIKKRGKYGKNACVRCKRLKVKCEQNKTPCARCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 10.5, mito 7, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MIKKRGKYGKNACVRCKRLKVKCEQNKTPCARCAKAHSPCERINKRQGVKIVADVGTYGQGYPGAGTAIAGPSGSGTSASEQLTVDDDDDEDGDEASVDEDDVGDSEEWEVERVYASAQNDLYVCV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.82
3 0.82
4 0.82
5 0.81
6 0.82
7 0.82
8 0.83
9 0.86
10 0.87
11 0.86
12 0.84
13 0.84
14 0.83
15 0.78
16 0.73
17 0.7
18 0.62
19 0.56
20 0.57
21 0.57
22 0.59
23 0.61
24 0.61
25 0.6
26 0.63
27 0.7
28 0.68
29 0.64
30 0.64
31 0.64
32 0.61
33 0.59
34 0.56
35 0.49
36 0.44
37 0.4
38 0.33
39 0.24
40 0.22
41 0.17
42 0.14
43 0.11
44 0.09
45 0.07
46 0.04
47 0.04
48 0.04
49 0.04
50 0.04
51 0.03
52 0.03
53 0.03
54 0.03
55 0.04
56 0.04
57 0.03
58 0.03
59 0.03
60 0.03
61 0.03
62 0.03
63 0.04
64 0.05
65 0.08
66 0.08
67 0.09
68 0.09
69 0.09
70 0.11
71 0.11
72 0.1
73 0.08
74 0.07
75 0.07
76 0.07
77 0.07
78 0.06
79 0.05
80 0.05
81 0.05
82 0.05
83 0.05
84 0.05
85 0.04
86 0.04
87 0.04
88 0.04
89 0.04
90 0.06
91 0.06
92 0.06
93 0.06
94 0.07
95 0.08
96 0.08
97 0.08
98 0.07
99 0.07
100 0.07
101 0.09
102 0.12
103 0.13
104 0.16
105 0.16
106 0.18