Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7PJV6

Protein Details
Accession A0A4Y7PJV6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
222-241GEERRRNSNKVPKRRWVGALHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 7, cyto 6, plas 6, extr 4, mito_nucl 4, cyto_pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR039960  MCP1  
IPR012472  MCP1_TM  
IPR034804  SQR/QFR_C/D  
Gene Ontology GO:0016020  C:membrane  
GO:0055088  P:lipid homeostasis  
Pfam View protein in Pfam  
PF07950  MCP1_TM  
Amino Acid Sequences MPPEPATARHGSFSLSSPYWSITTLRRRLTPVLTTISHVPTPFITTFLLIHLSAPAMANFGGSELSSQVMLLGREYYQSTPTQEWLLVYTPLLIHFSAGALKRLLSPAPFKISSPRRTLLTLTAYIAPLFLPLHILTNRVHPTSPDIPVLAVGPGELDYEFVKVGLVGEGRWRSWAAYAALVGCVGLHAVEGWSVLWGTWVLPPRQRQRQQQLELEDGGGGGEERRRNSNKVPKRRWVGALGALAVLSGLAVIAQEPLYALPSLVARYRAAYELSPFFRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.22
3 0.22
4 0.21
5 0.23
6 0.22
7 0.21
8 0.21
9 0.23
10 0.33
11 0.39
12 0.42
13 0.44
14 0.48
15 0.51
16 0.54
17 0.49
18 0.44
19 0.42
20 0.39
21 0.38
22 0.37
23 0.36
24 0.32
25 0.28
26 0.24
27 0.19
28 0.23
29 0.21
30 0.19
31 0.15
32 0.15
33 0.15
34 0.15
35 0.16
36 0.12
37 0.12
38 0.1
39 0.1
40 0.09
41 0.1
42 0.08
43 0.07
44 0.07
45 0.07
46 0.06
47 0.06
48 0.06
49 0.05
50 0.06
51 0.05
52 0.06
53 0.05
54 0.05
55 0.06
56 0.07
57 0.07
58 0.08
59 0.08
60 0.08
61 0.09
62 0.11
63 0.11
64 0.12
65 0.13
66 0.16
67 0.16
68 0.18
69 0.18
70 0.16
71 0.16
72 0.15
73 0.15
74 0.12
75 0.11
76 0.1
77 0.09
78 0.09
79 0.1
80 0.08
81 0.07
82 0.06
83 0.07
84 0.1
85 0.1
86 0.11
87 0.1
88 0.11
89 0.11
90 0.13
91 0.13
92 0.11
93 0.14
94 0.15
95 0.2
96 0.2
97 0.2
98 0.28
99 0.35
100 0.38
101 0.4
102 0.4
103 0.36
104 0.37
105 0.38
106 0.33
107 0.29
108 0.24
109 0.2
110 0.19
111 0.18
112 0.16
113 0.15
114 0.1
115 0.08
116 0.07
117 0.05
118 0.05
119 0.05
120 0.08
121 0.08
122 0.1
123 0.1
124 0.16
125 0.18
126 0.17
127 0.17
128 0.14
129 0.2
130 0.22
131 0.23
132 0.18
133 0.16
134 0.15
135 0.15
136 0.15
137 0.09
138 0.06
139 0.04
140 0.04
141 0.04
142 0.04
143 0.04
144 0.04
145 0.04
146 0.05
147 0.05
148 0.05
149 0.05
150 0.04
151 0.05
152 0.05
153 0.05
154 0.04
155 0.09
156 0.1
157 0.1
158 0.12
159 0.12
160 0.11
161 0.12
162 0.15
163 0.12
164 0.12
165 0.12
166 0.11
167 0.11
168 0.1
169 0.09
170 0.05
171 0.04
172 0.03
173 0.03
174 0.02
175 0.02
176 0.03
177 0.03
178 0.03
179 0.03
180 0.04
181 0.04
182 0.04
183 0.04
184 0.04
185 0.05
186 0.08
187 0.12
188 0.14
189 0.19
190 0.28
191 0.36
192 0.47
193 0.54
194 0.61
195 0.67
196 0.75
197 0.77
198 0.75
199 0.71
200 0.64
201 0.56
202 0.47
203 0.36
204 0.25
205 0.19
206 0.12
207 0.08
208 0.06
209 0.09
210 0.12
211 0.14
212 0.22
213 0.26
214 0.31
215 0.4
216 0.51
217 0.57
218 0.65
219 0.72
220 0.75
221 0.79
222 0.8
223 0.75
224 0.68
225 0.63
226 0.57
227 0.51
228 0.41
229 0.34
230 0.27
231 0.22
232 0.17
233 0.12
234 0.05
235 0.03
236 0.02
237 0.02
238 0.02
239 0.02
240 0.04
241 0.04
242 0.04
243 0.05
244 0.05
245 0.07
246 0.07
247 0.07
248 0.07
249 0.09
250 0.11
251 0.14
252 0.16
253 0.15
254 0.17
255 0.19
256 0.2
257 0.21
258 0.21
259 0.23
260 0.28