Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7PLR3

Protein Details
Accession A0A4Y7PLR3    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
151-176DSGLCKGGCTWRRRRHARTRTQTSCTHydrophilic
NLS Segment(s)
PositionSequence
12-14RRR
Subcellular Location(s) nucl 19, cyto_nucl 12, mito 5
Family & Domain DBs
Amino Acid Sequences MTPIGGSGGGRRRRDEGAKAAHGKAGIQAGLDNLNQQQQTIAPQPNNTPAPPCTAIGAISYYNQRIRSCREGLRYRRWRSRCRTYGGGNTECWVWCVKVEPFESGWCLKRRRWREGTHGRRNADDRSRGSSIDNSNSDNGGHGRSGGGRDDSGLCKGGCTWRRRRHARTRTQTSCT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.51
3 0.5
4 0.51
5 0.57
6 0.59
7 0.56
8 0.51
9 0.45
10 0.39
11 0.32
12 0.26
13 0.18
14 0.13
15 0.12
16 0.11
17 0.14
18 0.13
19 0.12
20 0.1
21 0.14
22 0.14
23 0.13
24 0.13
25 0.11
26 0.16
27 0.2
28 0.25
29 0.22
30 0.24
31 0.26
32 0.33
33 0.34
34 0.31
35 0.28
36 0.24
37 0.28
38 0.28
39 0.26
40 0.21
41 0.19
42 0.18
43 0.16
44 0.16
45 0.11
46 0.1
47 0.12
48 0.13
49 0.15
50 0.18
51 0.18
52 0.19
53 0.25
54 0.29
55 0.32
56 0.34
57 0.4
58 0.47
59 0.53
60 0.61
61 0.65
62 0.67
63 0.72
64 0.74
65 0.75
66 0.74
67 0.78
68 0.73
69 0.69
70 0.66
71 0.61
72 0.62
73 0.59
74 0.52
75 0.41
76 0.36
77 0.3
78 0.25
79 0.21
80 0.15
81 0.08
82 0.07
83 0.1
84 0.1
85 0.14
86 0.15
87 0.16
88 0.16
89 0.17
90 0.19
91 0.18
92 0.22
93 0.23
94 0.26
95 0.28
96 0.37
97 0.43
98 0.51
99 0.56
100 0.57
101 0.62
102 0.71
103 0.77
104 0.79
105 0.79
106 0.71
107 0.67
108 0.64
109 0.61
110 0.56
111 0.52
112 0.44
113 0.44
114 0.44
115 0.4
116 0.39
117 0.38
118 0.35
119 0.35
120 0.34
121 0.29
122 0.29
123 0.29
124 0.27
125 0.23
126 0.2
127 0.14
128 0.13
129 0.11
130 0.11
131 0.12
132 0.14
133 0.14
134 0.15
135 0.13
136 0.15
137 0.18
138 0.19
139 0.2
140 0.21
141 0.18
142 0.17
143 0.19
144 0.27
145 0.31
146 0.37
147 0.46
148 0.53
149 0.64
150 0.74
151 0.82
152 0.84
153 0.88
154 0.91
155 0.91
156 0.92