Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7PHF7

Protein Details
Accession A0A4Y7PHF7    Localization Confidence Medium Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
14-35NSTTNTIPSRNQNRNPRPCGNCHydrophilic
68-90VQRNAGKRRAPNRKRNHAPPAERBasic
NLS Segment(s)
PositionSequence
73-84GKRRAPNRKRNH
Subcellular Location(s) nucl 15.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
Amino Acid Sequences MLPPPMGPPNTHYNSTTNTIPSRNQNRNPRPCGNCTGSKVRCVVSHPYTKSLCKRCEEYGLAECPPYVQRNAGKRRAPNRKRNHAPPAERTDAAGTVFVYENVSTPNNTEVSQVGRSEIDSVAQHNQSAGNVHYSVAHGSGDAIPGGQLANDIGSVSGNTPSTSTTPANKFEALNENAIINNETAVENPIFAYNWFDSFNEVAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.39
4 0.34
5 0.33
6 0.33
7 0.36
8 0.43
9 0.48
10 0.54
11 0.6
12 0.67
13 0.74
14 0.81
15 0.85
16 0.84
17 0.8
18 0.76
19 0.74
20 0.69
21 0.65
22 0.61
23 0.63
24 0.56
25 0.54
26 0.51
27 0.44
28 0.4
29 0.37
30 0.39
31 0.36
32 0.42
33 0.41
34 0.45
35 0.46
36 0.5
37 0.56
38 0.56
39 0.54
40 0.5
41 0.52
42 0.49
43 0.53
44 0.48
45 0.44
46 0.41
47 0.38
48 0.34
49 0.3
50 0.27
51 0.21
52 0.21
53 0.18
54 0.14
55 0.15
56 0.21
57 0.3
58 0.38
59 0.45
60 0.48
61 0.54
62 0.63
63 0.7
64 0.74
65 0.75
66 0.77
67 0.8
68 0.83
69 0.84
70 0.84
71 0.82
72 0.78
73 0.75
74 0.72
75 0.64
76 0.56
77 0.48
78 0.39
79 0.31
80 0.25
81 0.18
82 0.1
83 0.08
84 0.08
85 0.07
86 0.07
87 0.06
88 0.06
89 0.07
90 0.08
91 0.06
92 0.07
93 0.09
94 0.09
95 0.09
96 0.1
97 0.09
98 0.11
99 0.13
100 0.12
101 0.11
102 0.11
103 0.1
104 0.11
105 0.1
106 0.09
107 0.08
108 0.1
109 0.12
110 0.13
111 0.12
112 0.11
113 0.12
114 0.1
115 0.12
116 0.1
117 0.09
118 0.09
119 0.09
120 0.1
121 0.1
122 0.1
123 0.09
124 0.09
125 0.06
126 0.07
127 0.07
128 0.07
129 0.06
130 0.06
131 0.05
132 0.05
133 0.05
134 0.04
135 0.04
136 0.03
137 0.04
138 0.04
139 0.04
140 0.04
141 0.04
142 0.05
143 0.05
144 0.07
145 0.07
146 0.08
147 0.08
148 0.1
149 0.11
150 0.15
151 0.17
152 0.22
153 0.25
154 0.29
155 0.32
156 0.32
157 0.31
158 0.31
159 0.36
160 0.32
161 0.3
162 0.26
163 0.24
164 0.23
165 0.24
166 0.21
167 0.13
168 0.11
169 0.1
170 0.09
171 0.09
172 0.12
173 0.11
174 0.1
175 0.11
176 0.12
177 0.11
178 0.11
179 0.16
180 0.14
181 0.16
182 0.18
183 0.17
184 0.19