Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7Q3D9

Protein Details
Accession A0A4Y7Q3D9    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MSTTNPRKRHRRVVQSVNKADAEHydrophilic
70-90ELATRKKARTRSIRVTKETKEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 10.5, mito 7, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR046521  DUF6698  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF20414  DUF6698  
Amino Acid Sequences MSTTNPRKRHRRVVQSVNKADAENIPILTEAQLEAVNGELPVNGVARQIFKELQENLAQLREEQRDLRAELATRKKARTRSIRVTKETKEHFDVGDAARFFAVNRWAFIPNFTWMGEDILSVPDDDPELAHHVVPKKQFLQNYIDALPAAVRNNYRDEDFRAMFATDMGTIRSTKVHEVKLAAYKIFDKELADYITSSRGAGNEAVYQRAEDLLGFTPRDPNNPNSHDTYSNKPPFMFAEGDGLQSERMFRVETLAKTLRVILFGQSSVNSLSVANNDTYGKMWGVTTITAPLIAFATTVINYLLSRDREFTPRGKNTQMEYSARYARYRKLAETLQTFPAGRETLKFLNNIVFAGYSMDNGREAVEADDDEDLLQEIANAAAADSTLSALDQPEEAVNQPEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.92
3 0.88
4 0.82
5 0.73
6 0.62
7 0.54
8 0.45
9 0.38
10 0.3
11 0.24
12 0.18
13 0.17
14 0.17
15 0.16
16 0.13
17 0.09
18 0.08
19 0.09
20 0.08
21 0.08
22 0.08
23 0.08
24 0.07
25 0.07
26 0.06
27 0.06
28 0.07
29 0.08
30 0.08
31 0.09
32 0.1
33 0.13
34 0.14
35 0.17
36 0.18
37 0.19
38 0.26
39 0.25
40 0.27
41 0.28
42 0.28
43 0.26
44 0.27
45 0.25
46 0.2
47 0.25
48 0.25
49 0.25
50 0.25
51 0.27
52 0.28
53 0.29
54 0.3
55 0.26
56 0.25
57 0.32
58 0.39
59 0.45
60 0.46
61 0.5
62 0.55
63 0.6
64 0.66
65 0.69
66 0.69
67 0.71
68 0.77
69 0.8
70 0.81
71 0.81
72 0.77
73 0.75
74 0.71
75 0.66
76 0.6
77 0.53
78 0.46
79 0.4
80 0.38
81 0.31
82 0.31
83 0.25
84 0.2
85 0.18
86 0.18
87 0.16
88 0.16
89 0.21
90 0.16
91 0.17
92 0.2
93 0.22
94 0.22
95 0.24
96 0.23
97 0.18
98 0.19
99 0.17
100 0.15
101 0.13
102 0.15
103 0.13
104 0.11
105 0.09
106 0.09
107 0.09
108 0.08
109 0.08
110 0.06
111 0.07
112 0.07
113 0.06
114 0.06
115 0.1
116 0.1
117 0.1
118 0.14
119 0.17
120 0.21
121 0.23
122 0.26
123 0.27
124 0.3
125 0.32
126 0.32
127 0.35
128 0.34
129 0.35
130 0.32
131 0.28
132 0.24
133 0.22
134 0.19
135 0.14
136 0.11
137 0.1
138 0.1
139 0.12
140 0.15
141 0.16
142 0.17
143 0.18
144 0.21
145 0.24
146 0.24
147 0.22
148 0.2
149 0.19
150 0.18
151 0.16
152 0.12
153 0.07
154 0.07
155 0.07
156 0.07
157 0.07
158 0.08
159 0.09
160 0.1
161 0.14
162 0.18
163 0.19
164 0.2
165 0.21
166 0.23
167 0.27
168 0.27
169 0.23
170 0.19
171 0.19
172 0.18
173 0.18
174 0.15
175 0.1
176 0.1
177 0.12
178 0.12
179 0.11
180 0.1
181 0.1
182 0.11
183 0.1
184 0.09
185 0.08
186 0.07
187 0.08
188 0.08
189 0.08
190 0.1
191 0.11
192 0.12
193 0.11
194 0.11
195 0.1
196 0.1
197 0.09
198 0.05
199 0.06
200 0.07
201 0.08
202 0.09
203 0.09
204 0.15
205 0.15
206 0.19
207 0.2
208 0.23
209 0.29
210 0.32
211 0.34
212 0.33
213 0.35
214 0.36
215 0.36
216 0.38
217 0.41
218 0.41
219 0.39
220 0.35
221 0.33
222 0.3
223 0.3
224 0.26
225 0.16
226 0.17
227 0.17
228 0.17
229 0.17
230 0.16
231 0.12
232 0.11
233 0.11
234 0.06
235 0.06
236 0.06
237 0.06
238 0.1
239 0.15
240 0.15
241 0.21
242 0.23
243 0.23
244 0.23
245 0.25
246 0.21
247 0.18
248 0.18
249 0.13
250 0.12
251 0.12
252 0.12
253 0.1
254 0.11
255 0.1
256 0.1
257 0.08
258 0.08
259 0.08
260 0.09
261 0.1
262 0.09
263 0.1
264 0.1
265 0.1
266 0.11
267 0.11
268 0.1
269 0.09
270 0.09
271 0.09
272 0.09
273 0.09
274 0.09
275 0.09
276 0.09
277 0.09
278 0.08
279 0.08
280 0.07
281 0.07
282 0.06
283 0.05
284 0.06
285 0.06
286 0.07
287 0.06
288 0.06
289 0.06
290 0.09
291 0.14
292 0.15
293 0.16
294 0.19
295 0.21
296 0.25
297 0.29
298 0.33
299 0.38
300 0.43
301 0.47
302 0.49
303 0.5
304 0.49
305 0.54
306 0.53
307 0.46
308 0.42
309 0.43
310 0.44
311 0.42
312 0.44
313 0.39
314 0.39
315 0.45
316 0.45
317 0.42
318 0.42
319 0.45
320 0.47
321 0.48
322 0.46
323 0.41
324 0.4
325 0.38
326 0.32
327 0.31
328 0.26
329 0.21
330 0.19
331 0.22
332 0.24
333 0.26
334 0.27
335 0.24
336 0.28
337 0.28
338 0.26
339 0.21
340 0.16
341 0.13
342 0.16
343 0.15
344 0.11
345 0.12
346 0.12
347 0.12
348 0.12
349 0.12
350 0.1
351 0.1
352 0.1
353 0.11
354 0.1
355 0.11
356 0.11
357 0.1
358 0.1
359 0.09
360 0.08
361 0.07
362 0.06
363 0.05
364 0.05
365 0.05
366 0.06
367 0.05
368 0.05
369 0.05
370 0.05
371 0.05
372 0.05
373 0.05
374 0.05
375 0.05
376 0.06
377 0.07
378 0.08
379 0.08
380 0.09
381 0.09
382 0.11
383 0.12