Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7QAW5

Protein Details
Accession A0A4Y7QAW5    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
64-90ERMHKRLSAKGKKWKWRQIFKVRSACAHydrophilic
NLS Segment(s)
PositionSequence
68-79KRLSAKGKKWKW
Subcellular Location(s) nucl 16, cyto_nucl 12, cyto 6, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013809  ENTH  
IPR008942  ENTH_VHS  
Gene Ontology GO:0051179  P:localization  
Pfam View protein in Pfam  
PF01417  ENTH  
Amino Acid Sequences MSIEHFENVAPPVANDPTSGYSDVQAKIRDATSNDPSDWGPSGTQMREIAKLTYDRQGFAEVVERMHKRLSAKGKKWKWRQIFKVRSACAIFHMSRIYLYSCRLLLCWSISYTRVPRTASFTSRNTFSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.16
4 0.17
5 0.19
6 0.2
7 0.17
8 0.18
9 0.22
10 0.23
11 0.24
12 0.23
13 0.21
14 0.21
15 0.22
16 0.22
17 0.21
18 0.25
19 0.27
20 0.28
21 0.27
22 0.27
23 0.26
24 0.25
25 0.23
26 0.19
27 0.13
28 0.13
29 0.16
30 0.15
31 0.17
32 0.17
33 0.17
34 0.18
35 0.19
36 0.17
37 0.16
38 0.18
39 0.17
40 0.21
41 0.2
42 0.18
43 0.18
44 0.19
45 0.17
46 0.15
47 0.18
48 0.12
49 0.13
50 0.17
51 0.16
52 0.16
53 0.16
54 0.18
55 0.14
56 0.2
57 0.3
58 0.36
59 0.43
60 0.53
61 0.61
62 0.69
63 0.78
64 0.81
65 0.8
66 0.8
67 0.83
68 0.83
69 0.84
70 0.83
71 0.83
72 0.74
73 0.69
74 0.61
75 0.51
76 0.43
77 0.39
78 0.3
79 0.23
80 0.23
81 0.18
82 0.17
83 0.18
84 0.18
85 0.14
86 0.16
87 0.16
88 0.16
89 0.16
90 0.16
91 0.16
92 0.16
93 0.16
94 0.16
95 0.16
96 0.17
97 0.18
98 0.24
99 0.27
100 0.3
101 0.32
102 0.33
103 0.33
104 0.39
105 0.44
106 0.44
107 0.46
108 0.46
109 0.46