Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7QKL3

Protein Details
Accession A0A4Y7QKL3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
73-93GDKKVVADARRSRRRRRRAHPBasic
NLS Segment(s)
PositionSequence
81-93ARRSRRRRRRAHP
Subcellular Location(s) extr 12, plas 11, E.R. 2
Family & Domain DBs
Amino Acid Sequences MQFSTVLFTLFAFVLATTAQPQTQTSVHETSEVVGYAASIEQIRLNELNGPNLSLAAKVAAMLFPSASPEDHGDKKVVADARRSRRRRRRAHP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.07
4 0.07
5 0.08
6 0.08
7 0.09
8 0.1
9 0.12
10 0.13
11 0.15
12 0.18
13 0.19
14 0.19
15 0.19
16 0.19
17 0.16
18 0.16
19 0.13
20 0.09
21 0.07
22 0.06
23 0.05
24 0.05
25 0.05
26 0.04
27 0.04
28 0.05
29 0.05
30 0.07
31 0.07
32 0.07
33 0.1
34 0.11
35 0.13
36 0.12
37 0.13
38 0.11
39 0.11
40 0.11
41 0.07
42 0.07
43 0.05
44 0.05
45 0.04
46 0.05
47 0.04
48 0.05
49 0.05
50 0.05
51 0.04
52 0.07
53 0.07
54 0.07
55 0.09
56 0.12
57 0.16
58 0.19
59 0.21
60 0.2
61 0.2
62 0.2
63 0.24
64 0.26
65 0.24
66 0.3
67 0.39
68 0.48
69 0.59
70 0.66
71 0.72
72 0.78
73 0.86