Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7Q6V3

Protein Details
Accession A0A4Y7Q6V3    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-32MSQCPRPRLRLSPRPRPRPRPRPAPPPRGAHCBasic
NLS Segment(s)
PositionSequence
7-29PRLRLSPRPRPRPRPRPAPPPRG
Subcellular Location(s) mito 16, nucl 7, cyto 4
Family & Domain DBs
Amino Acid Sequences MSQCPRPRLRLSPRPRPRPRPRPAPPPRGAHCPPRVPLKLDKLFMVVQIQENAFHISSHAAFYATCKRNLVESTVTVPLRSFFP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.89
3 0.9
4 0.91
5 0.91
6 0.91
7 0.91
8 0.89
9 0.89
10 0.89
11 0.88
12 0.84
13 0.81
14 0.76
15 0.74
16 0.68
17 0.66
18 0.62
19 0.56
20 0.53
21 0.52
22 0.5
23 0.45
24 0.47
25 0.48
26 0.46
27 0.41
28 0.39
29 0.33
30 0.31
31 0.28
32 0.23
33 0.15
34 0.11
35 0.12
36 0.12
37 0.09
38 0.1
39 0.11
40 0.1
41 0.09
42 0.09
43 0.09
44 0.09
45 0.1
46 0.09
47 0.08
48 0.07
49 0.11
50 0.21
51 0.23
52 0.24
53 0.25
54 0.25
55 0.29
56 0.3
57 0.32
58 0.25
59 0.24
60 0.27
61 0.32
62 0.32
63 0.28
64 0.27