Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7QCT8

Protein Details
Accession A0A4Y7QCT8    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-34VNIPKTRRTYCKGKTCKKHTPHKVTQYKKGKDSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, mito 10, cyto_nucl 9, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNIPKTRRTYCKGKTCKKHTPHKVTQYKKGKDSIFAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECTVCKFKMQLALKRCKHFELGGDKKTKGAALTFVSHTFF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.84
3 0.85
4 0.89
5 0.88
6 0.89
7 0.89
8 0.88
9 0.88
10 0.88
11 0.89
12 0.86
13 0.87
14 0.86
15 0.82
16 0.76
17 0.72
18 0.62
19 0.57
20 0.54
21 0.53
22 0.52
23 0.51
24 0.53
25 0.52
26 0.56
27 0.58
28 0.61
29 0.56
30 0.57
31 0.62
32 0.6
33 0.62
34 0.6
35 0.59
36 0.58
37 0.6
38 0.51
39 0.46
40 0.42
41 0.34
42 0.36
43 0.37
44 0.35
45 0.3
46 0.36
47 0.4
48 0.48
49 0.57
50 0.6
51 0.59
52 0.63
53 0.7
54 0.71
55 0.69
56 0.65
57 0.6
58 0.57
59 0.55
60 0.51
61 0.46
62 0.42
63 0.36
64 0.31
65 0.27
66 0.24
67 0.29
68 0.33
69 0.37
70 0.42
71 0.52
72 0.56
73 0.62
74 0.63
75 0.56
76 0.52
77 0.46
78 0.45
79 0.45
80 0.48
81 0.49
82 0.52
83 0.5
84 0.47
85 0.47
86 0.41
87 0.31
88 0.24
89 0.22
90 0.2
91 0.24
92 0.26