Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y7Q597

Protein Details
Accession A0A4Y7Q597    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
55-74DEDVKRTRGRPNRTDRSRLCBasic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 3, cyto 3, extr 3, cyto_nucl 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MARAGYFYPVQRRRSVRFIAICRPFHLVSLFPGIGIVELPIFYASVPYIKQRYTDEDVKRTRGRPNRTDRSRLCEFDGPPLRAFINRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.59
3 0.57
4 0.58
5 0.59
6 0.61
7 0.63
8 0.58
9 0.53
10 0.53
11 0.45
12 0.38
13 0.33
14 0.25
15 0.18
16 0.22
17 0.2
18 0.14
19 0.14
20 0.13
21 0.11
22 0.1
23 0.08
24 0.03
25 0.03
26 0.03
27 0.03
28 0.03
29 0.03
30 0.04
31 0.04
32 0.05
33 0.05
34 0.08
35 0.1
36 0.1
37 0.12
38 0.14
39 0.2
40 0.25
41 0.33
42 0.35
43 0.42
44 0.45
45 0.5
46 0.52
47 0.49
48 0.52
49 0.53
50 0.57
51 0.59
52 0.66
53 0.71
54 0.73
55 0.8
56 0.75
57 0.74
58 0.72
59 0.65
60 0.61
61 0.56
62 0.5
63 0.5
64 0.55
65 0.5
66 0.44
67 0.43
68 0.38