Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9MR75

Protein Details
Accession G9MR75    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
177-198LDAAAAERRRKQRRLKICIILLHydrophilic
NLS Segment(s)
PositionSequence
185-187RRK
Subcellular Location(s) nucl 8plas 8, cyto 4, extr 2, mito 1, pero 1, E.R. 1, golg 1, vacu 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MDSYDDDIQRQQYHPSHSIPDAAYPDDSPFRHQQLQASYGAGSFGASPSHPSHGMTPLPSHVGSQPGYQSQHQHQHQPQNQGAWQPYDIPSSPPPPYDPSQAPSAYQYTQIDATIPTNPATRPNARIDVHVQTGGIEMMPLQGATTAMSPQLAPLAPGASTSALTQASNAVEDPYKLDAAAAERRRKQRRLKICIILLAVVFMFCGALIIGVALGVVKGALNKPPDHGPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.42
3 0.42
4 0.4
5 0.43
6 0.36
7 0.36
8 0.31
9 0.28
10 0.26
11 0.22
12 0.24
13 0.25
14 0.25
15 0.26
16 0.29
17 0.33
18 0.37
19 0.38
20 0.4
21 0.4
22 0.43
23 0.38
24 0.34
25 0.28
26 0.23
27 0.21
28 0.16
29 0.1
30 0.07
31 0.07
32 0.06
33 0.06
34 0.1
35 0.11
36 0.15
37 0.15
38 0.16
39 0.18
40 0.22
41 0.23
42 0.21
43 0.21
44 0.19
45 0.21
46 0.2
47 0.19
48 0.16
49 0.18
50 0.17
51 0.17
52 0.18
53 0.19
54 0.22
55 0.22
56 0.26
57 0.28
58 0.36
59 0.37
60 0.43
61 0.45
62 0.53
63 0.57
64 0.6
65 0.56
66 0.5
67 0.49
68 0.44
69 0.4
70 0.31
71 0.26
72 0.2
73 0.2
74 0.19
75 0.18
76 0.17
77 0.18
78 0.2
79 0.21
80 0.19
81 0.2
82 0.22
83 0.24
84 0.26
85 0.25
86 0.23
87 0.26
88 0.26
89 0.24
90 0.22
91 0.22
92 0.17
93 0.18
94 0.16
95 0.13
96 0.13
97 0.13
98 0.11
99 0.1
100 0.1
101 0.09
102 0.09
103 0.09
104 0.1
105 0.1
106 0.13
107 0.17
108 0.18
109 0.2
110 0.23
111 0.28
112 0.28
113 0.3
114 0.29
115 0.28
116 0.27
117 0.24
118 0.2
119 0.14
120 0.14
121 0.12
122 0.08
123 0.05
124 0.04
125 0.04
126 0.04
127 0.03
128 0.03
129 0.03
130 0.03
131 0.04
132 0.05
133 0.05
134 0.05
135 0.05
136 0.05
137 0.05
138 0.07
139 0.06
140 0.06
141 0.06
142 0.07
143 0.06
144 0.07
145 0.07
146 0.06
147 0.07
148 0.07
149 0.08
150 0.08
151 0.08
152 0.08
153 0.09
154 0.09
155 0.09
156 0.09
157 0.09
158 0.09
159 0.09
160 0.11
161 0.11
162 0.11
163 0.1
164 0.1
165 0.09
166 0.13
167 0.22
168 0.27
169 0.33
170 0.4
171 0.51
172 0.59
173 0.67
174 0.74
175 0.75
176 0.79
177 0.81
178 0.83
179 0.82
180 0.77
181 0.73
182 0.63
183 0.54
184 0.43
185 0.34
186 0.24
187 0.15
188 0.11
189 0.07
190 0.05
191 0.03
192 0.04
193 0.03
194 0.03
195 0.03
196 0.03
197 0.03
198 0.03
199 0.03
200 0.03
201 0.03
202 0.02
203 0.03
204 0.03
205 0.05
206 0.07
207 0.12
208 0.16
209 0.18
210 0.21
211 0.27