Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G9MXU1

Protein Details
Accession G9MXU1    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
40-82AVVCLRLWERRKKRRKGKGDERHEDRRRRRRLQREKQPAEQRVBasic
NLS Segment(s)
PositionSequence
49-77RRKKRRKGKGDERHEDRRRRRRLQREKQP
Subcellular Location(s) extr 7, cyto_nucl 5.5, cyto 5, nucl 4, E.R. 4, mito 3, plas 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MHLPLRLLVDIFILAVGAALSYTLGVKNGQVVHQAISIGAVVCLRLWERRKKRRKGKGDERHEDRRRRRRLQREKQPAEQRVGEEKPRFEEEKQHVEDETGRVEEKHQHHEGLEERKHDLREI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.04
3 0.04
4 0.03
5 0.03
6 0.02
7 0.03
8 0.03
9 0.04
10 0.04
11 0.05
12 0.05
13 0.06
14 0.1
15 0.11
16 0.12
17 0.14
18 0.15
19 0.15
20 0.16
21 0.15
22 0.12
23 0.11
24 0.1
25 0.07
26 0.06
27 0.05
28 0.04
29 0.04
30 0.05
31 0.06
32 0.11
33 0.17
34 0.27
35 0.38
36 0.49
37 0.59
38 0.69
39 0.79
40 0.84
41 0.89
42 0.9
43 0.91
44 0.91
45 0.91
46 0.89
47 0.86
48 0.86
49 0.83
50 0.81
51 0.8
52 0.8
53 0.79
54 0.79
55 0.82
56 0.83
57 0.87
58 0.88
59 0.89
60 0.91
61 0.87
62 0.87
63 0.86
64 0.79
65 0.72
66 0.63
67 0.54
68 0.49
69 0.46
70 0.44
71 0.37
72 0.35
73 0.34
74 0.37
75 0.37
76 0.32
77 0.38
78 0.37
79 0.44
80 0.45
81 0.42
82 0.38
83 0.36
84 0.38
85 0.3
86 0.26
87 0.18
88 0.16
89 0.15
90 0.17
91 0.24
92 0.26
93 0.32
94 0.32
95 0.32
96 0.32
97 0.37
98 0.42
99 0.43
100 0.44
101 0.38
102 0.4
103 0.44