Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9MNY8

Protein Details
Accession G9MNY8   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
23-44AEAGRRSESKRKKRLEGCVEDGBasic
NLS Segment(s)
PositionSequence
27-36RRSESKRKKR
Subcellular Location(s) mito 18, cyto 5, nucl 2
Family & Domain DBs
Amino Acid Sequences MRITSGGLRQLNTLVGLDDRSGAEAGRRSESKRKKRLEGCVEDGGKRRQKNAIVNTQTRNKRPSTSHISPVTTCRAAQEMALAGKYSLITMAEMAQVLLPSHLRRTEMVGGSIWSTLCAGHAAADWPALGCVTGTIDRLSVYRSEGRAVFFVIRSTVTTVASGVAVRQDGGVALVMEGAQKRRAPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.12
4 0.11
5 0.11
6 0.1
7 0.11
8 0.11
9 0.1
10 0.12
11 0.16
12 0.18
13 0.22
14 0.24
15 0.28
16 0.38
17 0.49
18 0.57
19 0.62
20 0.68
21 0.72
22 0.78
23 0.83
24 0.84
25 0.81
26 0.76
27 0.75
28 0.69
29 0.63
30 0.6
31 0.58
32 0.54
33 0.47
34 0.44
35 0.41
36 0.45
37 0.51
38 0.53
39 0.55
40 0.56
41 0.6
42 0.63
43 0.66
44 0.66
45 0.61
46 0.57
47 0.49
48 0.46
49 0.44
50 0.47
51 0.48
52 0.47
53 0.5
54 0.5
55 0.5
56 0.46
57 0.45
58 0.42
59 0.33
60 0.28
61 0.21
62 0.18
63 0.16
64 0.15
65 0.13
66 0.1
67 0.09
68 0.09
69 0.08
70 0.07
71 0.07
72 0.07
73 0.05
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.04
81 0.04
82 0.04
83 0.04
84 0.04
85 0.04
86 0.05
87 0.05
88 0.07
89 0.08
90 0.09
91 0.09
92 0.13
93 0.18
94 0.17
95 0.18
96 0.17
97 0.16
98 0.16
99 0.16
100 0.12
101 0.07
102 0.06
103 0.05
104 0.05
105 0.05
106 0.05
107 0.05
108 0.05
109 0.06
110 0.06
111 0.06
112 0.06
113 0.05
114 0.05
115 0.05
116 0.04
117 0.03
118 0.03
119 0.05
120 0.06
121 0.07
122 0.08
123 0.08
124 0.09
125 0.09
126 0.1
127 0.09
128 0.12
129 0.15
130 0.16
131 0.19
132 0.19
133 0.21
134 0.2
135 0.22
136 0.2
137 0.16
138 0.16
139 0.14
140 0.14
141 0.13
142 0.15
143 0.14
144 0.13
145 0.13
146 0.12
147 0.12
148 0.11
149 0.1
150 0.08
151 0.09
152 0.08
153 0.08
154 0.08
155 0.07
156 0.07
157 0.08
158 0.08
159 0.06
160 0.06
161 0.06
162 0.06
163 0.08
164 0.11
165 0.12
166 0.16