Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9MLI0

Protein Details
Accession G9MLI0    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
232-259GKTTNGGARKPGRPKKDKKAAPVVGKTLHydrophilic
NLS Segment(s)
PositionSequence
232-261GKTTNGGARKPGRPKKDKKAAPVVGKTLRK
Subcellular Location(s) cyto 16.5, cyto_nucl 13.333, nucl 9, mito_nucl 5.333
Family & Domain DBs
Amino Acid Sequences MSDGIAPAVDKVGPPVSTAPEAQAGAPTVDMDPDTAKPEASVNLPTALEKPKEPPIIAETKAPEEAKPTEEPLKISEAFKLVHKIPRPVEVQSVPETPVNLATPVNGSPRPELNIPIEPEEPEKPQEDPVIITEVEEPLPTPTASAPGSDVGPDSIVDKPVTPNGESKPAELMAGALQTSTADAKSETSETATGEKRKADAAAATATDEPAAEKEDSEESEPADKKAKIDNGKTTNGGARKPGRPKKDKKAAPVVGKTLRKTRSQGPVEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.17
3 0.2
4 0.22
5 0.22
6 0.21
7 0.21
8 0.21
9 0.2
10 0.19
11 0.17
12 0.14
13 0.14
14 0.13
15 0.1
16 0.1
17 0.1
18 0.09
19 0.09
20 0.1
21 0.14
22 0.13
23 0.13
24 0.13
25 0.14
26 0.15
27 0.16
28 0.17
29 0.15
30 0.17
31 0.17
32 0.17
33 0.19
34 0.22
35 0.22
36 0.21
37 0.23
38 0.29
39 0.33
40 0.32
41 0.31
42 0.32
43 0.36
44 0.35
45 0.35
46 0.3
47 0.29
48 0.33
49 0.3
50 0.25
51 0.24
52 0.25
53 0.24
54 0.23
55 0.25
56 0.26
57 0.27
58 0.28
59 0.25
60 0.28
61 0.26
62 0.25
63 0.23
64 0.2
65 0.19
66 0.2
67 0.22
68 0.21
69 0.25
70 0.28
71 0.32
72 0.31
73 0.36
74 0.37
75 0.34
76 0.36
77 0.32
78 0.32
79 0.29
80 0.28
81 0.24
82 0.22
83 0.21
84 0.16
85 0.16
86 0.13
87 0.11
88 0.09
89 0.08
90 0.09
91 0.1
92 0.13
93 0.12
94 0.13
95 0.14
96 0.15
97 0.17
98 0.17
99 0.18
100 0.18
101 0.21
102 0.21
103 0.22
104 0.22
105 0.2
106 0.22
107 0.21
108 0.19
109 0.16
110 0.16
111 0.14
112 0.15
113 0.15
114 0.13
115 0.12
116 0.11
117 0.12
118 0.11
119 0.1
120 0.09
121 0.09
122 0.09
123 0.08
124 0.07
125 0.05
126 0.06
127 0.06
128 0.06
129 0.05
130 0.08
131 0.08
132 0.08
133 0.08
134 0.08
135 0.08
136 0.08
137 0.08
138 0.06
139 0.06
140 0.06
141 0.06
142 0.06
143 0.08
144 0.08
145 0.08
146 0.09
147 0.11
148 0.13
149 0.13
150 0.16
151 0.16
152 0.24
153 0.24
154 0.24
155 0.23
156 0.22
157 0.21
158 0.17
159 0.16
160 0.08
161 0.08
162 0.07
163 0.05
164 0.04
165 0.04
166 0.05
167 0.05
168 0.04
169 0.04
170 0.05
171 0.06
172 0.08
173 0.09
174 0.09
175 0.1
176 0.1
177 0.11
178 0.15
179 0.19
180 0.21
181 0.22
182 0.22
183 0.22
184 0.22
185 0.22
186 0.19
187 0.15
188 0.15
189 0.15
190 0.14
191 0.15
192 0.13
193 0.13
194 0.11
195 0.1
196 0.08
197 0.07
198 0.1
199 0.08
200 0.08
201 0.1
202 0.12
203 0.14
204 0.16
205 0.16
206 0.15
207 0.22
208 0.23
209 0.23
210 0.27
211 0.26
212 0.26
213 0.32
214 0.39
215 0.4
216 0.46
217 0.54
218 0.53
219 0.56
220 0.56
221 0.51
222 0.49
223 0.44
224 0.4
225 0.38
226 0.4
227 0.44
228 0.54
229 0.6
230 0.65
231 0.72
232 0.8
233 0.83
234 0.87
235 0.86
236 0.85
237 0.87
238 0.85
239 0.84
240 0.81
241 0.78
242 0.76
243 0.75
244 0.7
245 0.67
246 0.63
247 0.6
248 0.58
249 0.58
250 0.6