Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E2LHG4

Protein Details
Accession E2LHG4    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
81-105ETSLRSSTRRSPRKAEKKPVYVLNLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, cyto_nucl 4, nucl 3.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR014721  Ribosomal_S5_D2-typ_fold_subgr  
KEGG mpr:MPER_05942  -  
Amino Acid Sequences YGGGPRLFCTSLRLRLRIFKGKHIPGAQDRLNFVNFFPSIWRSIVPNINRHPVEHGELQRIIESRFTSSTFSKHAFEESGETSLRSSTRRSPRKAEKKPVYVLNLVIPRDKIDNLLEPAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.49
3 0.56
4 0.59
5 0.56
6 0.56
7 0.59
8 0.61
9 0.65
10 0.59
11 0.58
12 0.54
13 0.58
14 0.52
15 0.45
16 0.42
17 0.37
18 0.36
19 0.3
20 0.24
21 0.22
22 0.18
23 0.16
24 0.16
25 0.15
26 0.16
27 0.16
28 0.17
29 0.13
30 0.17
31 0.23
32 0.24
33 0.29
34 0.3
35 0.37
36 0.36
37 0.35
38 0.34
39 0.3
40 0.31
41 0.29
42 0.27
43 0.23
44 0.24
45 0.23
46 0.22
47 0.2
48 0.17
49 0.13
50 0.12
51 0.11
52 0.12
53 0.12
54 0.14
55 0.14
56 0.16
57 0.17
58 0.18
59 0.18
60 0.17
61 0.18
62 0.16
63 0.15
64 0.17
65 0.15
66 0.15
67 0.14
68 0.14
69 0.13
70 0.13
71 0.14
72 0.12
73 0.14
74 0.21
75 0.32
76 0.41
77 0.46
78 0.55
79 0.65
80 0.75
81 0.82
82 0.84
83 0.83
84 0.82
85 0.83
86 0.81
87 0.74
88 0.65
89 0.56
90 0.52
91 0.48
92 0.41
93 0.37
94 0.31
95 0.27
96 0.28
97 0.27
98 0.23
99 0.21
100 0.26