Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V1Y114

Protein Details
Accession A0A4V1Y114    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
6-29AEQLWKFQVQHKKRPEKDPEAFYNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR011008  Dimeric_a/b-barrel  
IPR009799  EthD_dom  
Gene Ontology GO:0016491  F:oxidoreductase activity  
Pfam View protein in Pfam  
PF07110  EthD  
Amino Acid Sequences MSEKPAEQLWKFQVQHKKRPEKDPEAFYNWYKDKLMPECVRLVKKYNIPRYSVFYTPPALRQPWREEFDNRLQKPHWGIPDWDATTCYWVHHPDDIRKLQADPEWTSRVNAMEEDWIASAVHISIGYETVYFDDGKVLNTTVAAD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.65
3 0.69
4 0.75
5 0.73
6 0.81
7 0.83
8 0.83
9 0.83
10 0.81
11 0.77
12 0.72
13 0.68
14 0.6
15 0.58
16 0.5
17 0.44
18 0.38
19 0.33
20 0.33
21 0.33
22 0.4
23 0.35
24 0.35
25 0.39
26 0.43
27 0.44
28 0.4
29 0.41
30 0.37
31 0.43
32 0.49
33 0.53
34 0.51
35 0.51
36 0.51
37 0.52
38 0.51
39 0.45
40 0.37
41 0.29
42 0.29
43 0.27
44 0.28
45 0.24
46 0.22
47 0.23
48 0.26
49 0.3
50 0.34
51 0.36
52 0.36
53 0.35
54 0.38
55 0.46
56 0.51
57 0.45
58 0.41
59 0.38
60 0.37
61 0.39
62 0.37
63 0.3
64 0.22
65 0.22
66 0.22
67 0.27
68 0.26
69 0.22
70 0.2
71 0.17
72 0.17
73 0.16
74 0.14
75 0.1
76 0.12
77 0.13
78 0.16
79 0.2
80 0.24
81 0.31
82 0.32
83 0.32
84 0.31
85 0.3
86 0.29
87 0.28
88 0.27
89 0.23
90 0.26
91 0.28
92 0.27
93 0.27
94 0.26
95 0.25
96 0.21
97 0.18
98 0.14
99 0.13
100 0.12
101 0.13
102 0.11
103 0.11
104 0.09
105 0.09
106 0.08
107 0.06
108 0.06
109 0.05
110 0.05
111 0.05
112 0.06
113 0.06
114 0.06
115 0.06
116 0.07
117 0.08
118 0.08
119 0.08
120 0.12
121 0.12
122 0.13
123 0.15
124 0.15
125 0.13