Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4YX80

Protein Details
Accession A0A4Q4YX80    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
16-41LWKTPWRLSRFQKARQRRRLRAVDAVHydrophilic
77-103KYTMFDRKEKRYRKGIHKLPKWTRVSQHydrophilic
NLS Segment(s)
PositionSequence
84-95KEKRYRKGIHKL
Subcellular Location(s) mito 23, cyto_mito 13.333, mito_nucl 12.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFRFTNPLSGGLLWKTPWRLSRFQKARQRRRLRAVDAVVDTLDKALAKKGETLKALEVWKETMPTEAEMLPRDKYTMFDRKEKRYRKGIHKLPKWTRVSQRVNPPGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.16
4 0.19
5 0.2
6 0.22
7 0.28
8 0.32
9 0.39
10 0.44
11 0.55
12 0.59
13 0.66
14 0.73
15 0.77
16 0.83
17 0.85
18 0.89
19 0.86
20 0.88
21 0.86
22 0.81
23 0.77
24 0.69
25 0.63
26 0.53
27 0.45
28 0.35
29 0.26
30 0.21
31 0.13
32 0.1
33 0.06
34 0.05
35 0.06
36 0.07
37 0.08
38 0.12
39 0.15
40 0.19
41 0.2
42 0.21
43 0.2
44 0.22
45 0.23
46 0.19
47 0.17
48 0.15
49 0.14
50 0.14
51 0.13
52 0.11
53 0.11
54 0.11
55 0.12
56 0.11
57 0.12
58 0.13
59 0.15
60 0.14
61 0.13
62 0.14
63 0.12
64 0.14
65 0.19
66 0.27
67 0.29
68 0.37
69 0.43
70 0.53
71 0.63
72 0.69
73 0.7
74 0.71
75 0.77
76 0.78
77 0.82
78 0.82
79 0.83
80 0.83
81 0.87
82 0.86
83 0.87
84 0.82
85 0.8
86 0.8
87 0.79
88 0.8
89 0.77
90 0.79