Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4Z5W9

Protein Details
Accession A0A4Q4Z5W9   
Localization Confidence Low
Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
72-95GALHRVHRRQRKRGAERVHHDRRRBasic
NLS Segment(s)
PositionSequence
77-101VHRRQRKRGAERVHHDRRRDGEKPE
Subcellular Location(s) mito 13, cyto 8, cyto_nucl 8, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR011042  6-blade_b-propeller_TolB-like  
IPR017996  Royal_jelly/protein_yellow  
Pfam View protein in Pfam  
PF03022  MRJP  
Amino Acid Sequences MLWVLDTGRPTAPQSGRTSMAYAVPGGSKLVAVDLATDTITRTYTLPPTVHYKDLYMVNLRFDLQFNPTESGALHRVHRRQRKRGAERVHHDRRRDGEKPEPARSAPEYASSLRGGAQLSGPAVLLLPERSSSVVSAGRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.36
3 0.38
4 0.38
5 0.37
6 0.3
7 0.29
8 0.24
9 0.19
10 0.15
11 0.13
12 0.12
13 0.11
14 0.09
15 0.07
16 0.06
17 0.07
18 0.06
19 0.05
20 0.06
21 0.06
22 0.07
23 0.07
24 0.07
25 0.07
26 0.07
27 0.08
28 0.07
29 0.08
30 0.1
31 0.12
32 0.15
33 0.15
34 0.17
35 0.24
36 0.26
37 0.27
38 0.26
39 0.24
40 0.23
41 0.25
42 0.25
43 0.21
44 0.19
45 0.18
46 0.18
47 0.18
48 0.15
49 0.14
50 0.13
51 0.11
52 0.12
53 0.13
54 0.14
55 0.13
56 0.13
57 0.12
58 0.14
59 0.15
60 0.14
61 0.15
62 0.18
63 0.25
64 0.33
65 0.43
66 0.49
67 0.56
68 0.64
69 0.72
70 0.76
71 0.79
72 0.8
73 0.8
74 0.8
75 0.81
76 0.82
77 0.76
78 0.7
79 0.66
80 0.62
81 0.6
82 0.56
83 0.51
84 0.5
85 0.54
86 0.58
87 0.58
88 0.56
89 0.48
90 0.48
91 0.45
92 0.39
93 0.3
94 0.27
95 0.25
96 0.23
97 0.25
98 0.21
99 0.19
100 0.16
101 0.17
102 0.14
103 0.12
104 0.12
105 0.11
106 0.11
107 0.11
108 0.1
109 0.08
110 0.08
111 0.08
112 0.08
113 0.08
114 0.09
115 0.09
116 0.1
117 0.11
118 0.12
119 0.12
120 0.15