Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2M6R4

Protein Details
Accession E2M6R4    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-26ESSISGSKTRPKHRKRSSTATGKGVHydrophilic
80-100AHNRGRECKKLKKSLHEAEKEBasic
NLS Segment(s)
PositionSequence
11-17RPKHRKR
Subcellular Location(s) nucl 14.5, mito 12, cyto_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR042791  CDK5RAP2  
IPR012943  Cnn_1N  
Gene Ontology GO:0005794  C:Golgi apparatus  
GO:0005815  C:microtubule organizing center  
GO:0000226  P:microtubule cytoskeleton organization  
KEGG mpr:MPER_16340  -  
Pfam View protein in Pfam  
PF07989  Cnn_1N  
Amino Acid Sequences MESSISGSKTRPKHRKRSSTATGKGVTLTLRDQEKHIDSITKENFDLKLRVHFLEERLAELAPEQMDAALKQNISLKIEAHNRGRECKKLKKSLHEAEKEIERLQRGAGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.87
3 0.88
4 0.89
5 0.88
6 0.88
7 0.84
8 0.8
9 0.71
10 0.6
11 0.52
12 0.43
13 0.33
14 0.24
15 0.19
16 0.17
17 0.18
18 0.18
19 0.19
20 0.22
21 0.24
22 0.24
23 0.23
24 0.22
25 0.2
26 0.28
27 0.29
28 0.26
29 0.24
30 0.24
31 0.25
32 0.23
33 0.24
34 0.16
35 0.19
36 0.19
37 0.19
38 0.2
39 0.19
40 0.18
41 0.22
42 0.21
43 0.17
44 0.15
45 0.15
46 0.12
47 0.12
48 0.12
49 0.06
50 0.06
51 0.05
52 0.05
53 0.05
54 0.06
55 0.08
56 0.08
57 0.08
58 0.09
59 0.14
60 0.15
61 0.17
62 0.18
63 0.16
64 0.21
65 0.27
66 0.32
67 0.33
68 0.39
69 0.39
70 0.47
71 0.5
72 0.53
73 0.54
74 0.59
75 0.63
76 0.67
77 0.72
78 0.73
79 0.8
80 0.81
81 0.84
82 0.8
83 0.73
84 0.68
85 0.67
86 0.59
87 0.52
88 0.46
89 0.38
90 0.32