Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q4XS56

Protein Details
Accession A0A4Q4XS56    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
129-154YGGATPTKKRQRRTPAPKKRAPVFKSHydrophilic
NLS Segment(s)
PositionSequence
82-108PKAKAGPKKGASSASAKGTSTGGRKRT
136-150KKRQRRTPAPKKRAP
Subcellular Location(s) cyto 13, cyto_nucl 12.5, nucl 10, mito 4
Family & Domain DBs
Amino Acid Sequences MADSNNTNEGAGGKWTDAEKASLMVQIIDQLTSAGGKVRLGELNMPGRTPKSLTHMLGKIKDEAAAHKGEGGSGSSSVPATPKAKAGPKKGASSASAKGTSTGGRKRTKTAAAATGSDAGDDGEKDGDYGGATPTKKRQRRTPAPKKRAPVFKSESKAEDTVSEDGEDEKKPDTTAIDAADAVNAAIAAANGAAALDGVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.15
4 0.15
5 0.15
6 0.14
7 0.14
8 0.15
9 0.14
10 0.14
11 0.12
12 0.11
13 0.13
14 0.12
15 0.11
16 0.1
17 0.08
18 0.08
19 0.08
20 0.08
21 0.08
22 0.08
23 0.08
24 0.09
25 0.11
26 0.13
27 0.14
28 0.16
29 0.18
30 0.24
31 0.24
32 0.24
33 0.23
34 0.23
35 0.23
36 0.23
37 0.2
38 0.2
39 0.25
40 0.27
41 0.32
42 0.36
43 0.39
44 0.41
45 0.4
46 0.36
47 0.3
48 0.3
49 0.24
50 0.21
51 0.2
52 0.17
53 0.15
54 0.15
55 0.14
56 0.12
57 0.12
58 0.1
59 0.08
60 0.08
61 0.08
62 0.07
63 0.07
64 0.07
65 0.07
66 0.1
67 0.1
68 0.1
69 0.12
70 0.16
71 0.23
72 0.29
73 0.34
74 0.4
75 0.42
76 0.44
77 0.44
78 0.43
79 0.38
80 0.35
81 0.32
82 0.26
83 0.23
84 0.2
85 0.19
86 0.18
87 0.18
88 0.19
89 0.21
90 0.25
91 0.3
92 0.31
93 0.34
94 0.37
95 0.38
96 0.37
97 0.35
98 0.34
99 0.3
100 0.29
101 0.27
102 0.25
103 0.22
104 0.18
105 0.15
106 0.09
107 0.08
108 0.07
109 0.06
110 0.04
111 0.04
112 0.05
113 0.05
114 0.05
115 0.04
116 0.05
117 0.06
118 0.09
119 0.1
120 0.12
121 0.21
122 0.31
123 0.37
124 0.42
125 0.51
126 0.58
127 0.69
128 0.79
129 0.82
130 0.83
131 0.88
132 0.89
133 0.87
134 0.84
135 0.83
136 0.75
137 0.73
138 0.68
139 0.66
140 0.65
141 0.6
142 0.55
143 0.49
144 0.47
145 0.38
146 0.33
147 0.28
148 0.24
149 0.21
150 0.18
151 0.14
152 0.15
153 0.17
154 0.16
155 0.14
156 0.14
157 0.14
158 0.14
159 0.15
160 0.15
161 0.15
162 0.17
163 0.17
164 0.16
165 0.16
166 0.16
167 0.15
168 0.13
169 0.1
170 0.07
171 0.05
172 0.04
173 0.04
174 0.04
175 0.03
176 0.03
177 0.03
178 0.03
179 0.03
180 0.03