Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4XCV4

Protein Details
Accession A0A4Q4XCV4   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
12-39SEPQEEWTKVRRKSRRNAGSKAPQKQLKHydrophilic
NLS Segment(s)
PositionSequence
21-44VRRKSRRNAGSKAPQKQLKAPLRK
Subcellular Location(s) mito 9, cyto_nucl 8.5, nucl 8, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR012942  SRR1-like  
Pfam View protein in Pfam  
PF07985  SRR1  
Amino Acid Sequences MAMQTCSSVRQSEPQEEWTKVRRKSRRNAGSKAPQKQLKAPLRKPTSSGTTTRLSVSDIQRDHERFSRQWQESSCRRQLRDLMASRTGRPTTTVSQAVCLGIGSFDPEDGAWEVKRRAHIQLAAFLSIVSELGRGGGGDGQQQQQPIRCYFQEPLFTPADETFIRGMGYEVLGSPSGFELVDRDTLVFGVHLYRDVYGQAIAKCVPAIFVGTGLDVWEGYHGSEGLDWAAMEELDRQCDRIQFPEDDGHTTFSSTSIHWRKSEHT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.47
3 0.48
4 0.51
5 0.53
6 0.56
7 0.56
8 0.63
9 0.65
10 0.69
11 0.77
12 0.83
13 0.84
14 0.84
15 0.84
16 0.84
17 0.85
18 0.85
19 0.83
20 0.81
21 0.75
22 0.7
23 0.7
24 0.7
25 0.69
26 0.71
27 0.69
28 0.71
29 0.73
30 0.71
31 0.66
32 0.62
33 0.59
34 0.53
35 0.49
36 0.43
37 0.39
38 0.39
39 0.37
40 0.31
41 0.26
42 0.28
43 0.29
44 0.32
45 0.29
46 0.31
47 0.37
48 0.38
49 0.39
50 0.39
51 0.4
52 0.34
53 0.42
54 0.48
55 0.44
56 0.47
57 0.47
58 0.5
59 0.53
60 0.6
61 0.6
62 0.56
63 0.55
64 0.55
65 0.56
66 0.55
67 0.56
68 0.53
69 0.48
70 0.5
71 0.5
72 0.47
73 0.46
74 0.39
75 0.3
76 0.27
77 0.27
78 0.22
79 0.26
80 0.28
81 0.23
82 0.24
83 0.24
84 0.22
85 0.17
86 0.14
87 0.09
88 0.06
89 0.05
90 0.05
91 0.05
92 0.04
93 0.05
94 0.04
95 0.06
96 0.06
97 0.08
98 0.07
99 0.09
100 0.11
101 0.12
102 0.16
103 0.16
104 0.18
105 0.2
106 0.23
107 0.22
108 0.26
109 0.25
110 0.23
111 0.21
112 0.18
113 0.15
114 0.11
115 0.1
116 0.04
117 0.03
118 0.03
119 0.03
120 0.03
121 0.03
122 0.03
123 0.04
124 0.04
125 0.06
126 0.08
127 0.09
128 0.11
129 0.12
130 0.13
131 0.15
132 0.18
133 0.18
134 0.19
135 0.18
136 0.2
137 0.21
138 0.24
139 0.25
140 0.24
141 0.27
142 0.25
143 0.25
144 0.23
145 0.21
146 0.2
147 0.15
148 0.15
149 0.11
150 0.1
151 0.1
152 0.09
153 0.09
154 0.07
155 0.07
156 0.05
157 0.05
158 0.06
159 0.06
160 0.06
161 0.06
162 0.05
163 0.06
164 0.05
165 0.05
166 0.05
167 0.07
168 0.08
169 0.08
170 0.08
171 0.08
172 0.08
173 0.08
174 0.07
175 0.06
176 0.06
177 0.06
178 0.07
179 0.07
180 0.08
181 0.08
182 0.08
183 0.09
184 0.09
185 0.12
186 0.11
187 0.13
188 0.13
189 0.13
190 0.13
191 0.12
192 0.11
193 0.08
194 0.09
195 0.07
196 0.08
197 0.07
198 0.07
199 0.07
200 0.07
201 0.07
202 0.05
203 0.05
204 0.06
205 0.06
206 0.06
207 0.07
208 0.06
209 0.06
210 0.07
211 0.07
212 0.06
213 0.07
214 0.06
215 0.06
216 0.06
217 0.06
218 0.06
219 0.11
220 0.12
221 0.16
222 0.17
223 0.18
224 0.19
225 0.24
226 0.26
227 0.26
228 0.3
229 0.27
230 0.3
231 0.36
232 0.36
233 0.35
234 0.35
235 0.33
236 0.29
237 0.27
238 0.24
239 0.18
240 0.18
241 0.15
242 0.24
243 0.28
244 0.33
245 0.34