Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4ZTJ5

Protein Details
Accession A0A4Q4ZTJ5    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
90-127YQRFHERPGLKRKRLKSERWQKRFKKGFKETVRRVRELBasic
NLS Segment(s)
PositionSequence
96-123RPGLKRKRLKSERWQKRFKKGFKETVRR
Subcellular Location(s) nucl 16.5, cyto_nucl 14, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001911  Ribosomal_S21  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01165  Ribosomal_S21  
Amino Acid Sequences MSQYYGSDPSESGFGEPTYDSVSQDVYIELSDLQKTKHSEAAPEAPKPTMRLVPRLGRTVHVSSNVDVARSFKILAIQVAQNRIRQDFQYQRFHERPGLKRKRLKSERWQKRFKKGFKETVRRVRELTKQGW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.12
4 0.12
5 0.14
6 0.14
7 0.14
8 0.12
9 0.13
10 0.12
11 0.12
12 0.12
13 0.08
14 0.07
15 0.07
16 0.07
17 0.08
18 0.09
19 0.1
20 0.1
21 0.15
22 0.18
23 0.19
24 0.24
25 0.23
26 0.24
27 0.28
28 0.36
29 0.34
30 0.33
31 0.32
32 0.28
33 0.28
34 0.28
35 0.26
36 0.23
37 0.21
38 0.24
39 0.27
40 0.33
41 0.35
42 0.37
43 0.35
44 0.31
45 0.34
46 0.31
47 0.28
48 0.24
49 0.22
50 0.19
51 0.23
52 0.21
53 0.17
54 0.15
55 0.15
56 0.12
57 0.11
58 0.11
59 0.07
60 0.09
61 0.09
62 0.1
63 0.1
64 0.12
65 0.13
66 0.19
67 0.2
68 0.21
69 0.22
70 0.23
71 0.22
72 0.21
73 0.27
74 0.31
75 0.36
76 0.43
77 0.45
78 0.51
79 0.52
80 0.53
81 0.53
82 0.52
83 0.54
84 0.55
85 0.63
86 0.64
87 0.7
88 0.76
89 0.8
90 0.81
91 0.82
92 0.82
93 0.82
94 0.85
95 0.86
96 0.9
97 0.86
98 0.88
99 0.89
100 0.86
101 0.86
102 0.85
103 0.85
104 0.86
105 0.89
106 0.88
107 0.88
108 0.87
109 0.79
110 0.73
111 0.7
112 0.68