Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q4ZY74

Protein Details
Accession A0A4Q4ZY74    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
115-134ADGPKPEQVKKAKRVQPLQKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16.5, mito_nucl 9.666, cyto 8, cyto_nucl 5.833
Family & Domain DBs
Amino Acid Sequences MPAVIVKLPAHTAPSADKLSLLSEQLKRLTLSELREVILALCIAGPLYRAFYDEVFQAVESYLVKKGCQSARDGLPPRLFDLGDGEPQGVVLEVSEKSEIACKRAMFMAKKIIGADGPKPEQVKKAKRVQPLQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.21
4 0.2
5 0.18
6 0.2
7 0.2
8 0.19
9 0.19
10 0.2
11 0.24
12 0.25
13 0.26
14 0.24
15 0.24
16 0.26
17 0.24
18 0.24
19 0.26
20 0.26
21 0.24
22 0.24
23 0.23
24 0.19
25 0.16
26 0.12
27 0.06
28 0.05
29 0.04
30 0.04
31 0.04
32 0.05
33 0.04
34 0.06
35 0.06
36 0.07
37 0.08
38 0.09
39 0.1
40 0.09
41 0.09
42 0.08
43 0.08
44 0.07
45 0.06
46 0.06
47 0.06
48 0.07
49 0.08
50 0.08
51 0.08
52 0.09
53 0.14
54 0.16
55 0.17
56 0.18
57 0.21
58 0.23
59 0.31
60 0.34
61 0.33
62 0.34
63 0.33
64 0.32
65 0.28
66 0.25
67 0.18
68 0.19
69 0.16
70 0.14
71 0.14
72 0.12
73 0.11
74 0.11
75 0.11
76 0.06
77 0.05
78 0.03
79 0.05
80 0.05
81 0.06
82 0.07
83 0.06
84 0.07
85 0.13
86 0.14
87 0.14
88 0.18
89 0.17
90 0.19
91 0.23
92 0.29
93 0.26
94 0.3
95 0.36
96 0.34
97 0.36
98 0.34
99 0.31
100 0.27
101 0.27
102 0.27
103 0.25
104 0.26
105 0.29
106 0.31
107 0.32
108 0.38
109 0.45
110 0.51
111 0.53
112 0.61
113 0.64
114 0.72