Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4V1XU72

Protein Details
Accession A0A4V1XU72    Localization Confidence High Confidence Score 18.3
NoLS Segment(s)
PositionSequenceProtein Nature
392-420QEDKREKELEEKLRRQKEERKKRLNQGQRBasic
NLS Segment(s)
PositionSequence
210-220KKDREPAKPGA
309-309R
311-312GK
398-416KELEEKLRRQKEERKKRLN
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR013256  Chromatin_SPT2  
Pfam View protein in Pfam  
PF08243  SPT2  
CDD cd22265  UDM1_RNF168  
Amino Acid Sequences MPIGDLLAEISGERPSAVAKTPPPSGIKRKADDLNGDSTKVAKARHTDVSTSKVTRDLQGSAIGLSRSDSRTAAKTAYTGTSARRRSPQPHQTSSPSTNGRTSKLTATNGQHTPGSIVNGRPAPSSASSSAQRKPASDVASRPKLNPPSLSAPKMPPAKPSPTTPTASDPGKAPKKGSFAEIMARGAKAQQVMGKVGVIQHKAIEKPVVKKDREPAKPGAKTPTGKPYLGNARPTTMPSRDATRPAGQAANAQRNGVGKDGKQAGKQRPGSSGGDVQEKKVKKSATATTGYTGTARPKPGASSSKSSARNGKPQASSRAGGLLGPPKSSRRSREEDYDEDLDDFIEYDDEDEPDPRGPGYSYGYDSDASSDMEAGLSDIDEEEARATKEAIQEDKREKELEEKLRRQKEERKKRLNQGQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.1
4 0.13
5 0.18
6 0.22
7 0.27
8 0.31
9 0.35
10 0.39
11 0.45
12 0.52
13 0.57
14 0.61
15 0.6
16 0.64
17 0.65
18 0.65
19 0.65
20 0.58
21 0.57
22 0.5
23 0.47
24 0.4
25 0.35
26 0.33
27 0.29
28 0.27
29 0.22
30 0.26
31 0.3
32 0.39
33 0.4
34 0.42
35 0.43
36 0.47
37 0.48
38 0.45
39 0.41
40 0.37
41 0.36
42 0.35
43 0.34
44 0.3
45 0.26
46 0.27
47 0.26
48 0.21
49 0.22
50 0.18
51 0.15
52 0.14
53 0.16
54 0.15
55 0.16
56 0.17
57 0.18
58 0.21
59 0.23
60 0.23
61 0.2
62 0.2
63 0.21
64 0.21
65 0.21
66 0.19
67 0.23
68 0.31
69 0.34
70 0.37
71 0.42
72 0.46
73 0.51
74 0.6
75 0.64
76 0.65
77 0.68
78 0.69
79 0.68
80 0.7
81 0.67
82 0.64
83 0.57
84 0.5
85 0.5
86 0.47
87 0.43
88 0.39
89 0.37
90 0.36
91 0.37
92 0.38
93 0.38
94 0.4
95 0.44
96 0.42
97 0.41
98 0.35
99 0.29
100 0.28
101 0.23
102 0.21
103 0.17
104 0.16
105 0.19
106 0.21
107 0.21
108 0.2
109 0.19
110 0.19
111 0.18
112 0.21
113 0.19
114 0.2
115 0.24
116 0.28
117 0.31
118 0.35
119 0.34
120 0.31
121 0.34
122 0.35
123 0.35
124 0.34
125 0.37
126 0.39
127 0.47
128 0.47
129 0.44
130 0.46
131 0.47
132 0.46
133 0.41
134 0.38
135 0.38
136 0.42
137 0.44
138 0.39
139 0.36
140 0.4
141 0.45
142 0.41
143 0.38
144 0.37
145 0.4
146 0.4
147 0.43
148 0.43
149 0.4
150 0.42
151 0.38
152 0.37
153 0.35
154 0.34
155 0.3
156 0.25
157 0.3
158 0.34
159 0.33
160 0.31
161 0.31
162 0.34
163 0.34
164 0.34
165 0.27
166 0.22
167 0.25
168 0.24
169 0.22
170 0.18
171 0.17
172 0.15
173 0.13
174 0.13
175 0.09
176 0.09
177 0.09
178 0.1
179 0.11
180 0.11
181 0.1
182 0.1
183 0.12
184 0.14
185 0.13
186 0.12
187 0.13
188 0.14
189 0.15
190 0.15
191 0.17
192 0.17
193 0.22
194 0.3
195 0.36
196 0.35
197 0.38
198 0.45
199 0.5
200 0.51
201 0.51
202 0.5
203 0.51
204 0.53
205 0.52
206 0.5
207 0.46
208 0.43
209 0.41
210 0.43
211 0.37
212 0.35
213 0.33
214 0.33
215 0.37
216 0.39
217 0.41
218 0.32
219 0.31
220 0.31
221 0.33
222 0.32
223 0.24
224 0.22
225 0.19
226 0.24
227 0.23
228 0.26
229 0.28
230 0.27
231 0.26
232 0.26
233 0.26
234 0.2
235 0.24
236 0.26
237 0.3
238 0.27
239 0.26
240 0.25
241 0.26
242 0.26
243 0.24
244 0.2
245 0.13
246 0.18
247 0.24
248 0.25
249 0.29
250 0.35
251 0.4
252 0.47
253 0.52
254 0.48
255 0.45
256 0.47
257 0.44
258 0.4
259 0.37
260 0.3
261 0.34
262 0.32
263 0.31
264 0.33
265 0.33
266 0.32
267 0.33
268 0.31
269 0.25
270 0.31
271 0.36
272 0.35
273 0.38
274 0.37
275 0.34
276 0.34
277 0.31
278 0.26
279 0.22
280 0.2
281 0.21
282 0.21
283 0.2
284 0.2
285 0.22
286 0.28
287 0.33
288 0.33
289 0.35
290 0.38
291 0.45
292 0.48
293 0.5
294 0.52
295 0.51
296 0.56
297 0.55
298 0.58
299 0.56
300 0.58
301 0.62
302 0.57
303 0.52
304 0.43
305 0.4
306 0.32
307 0.26
308 0.24
309 0.23
310 0.19
311 0.2
312 0.21
313 0.23
314 0.3
315 0.36
316 0.4
317 0.41
318 0.48
319 0.51
320 0.6
321 0.63
322 0.6
323 0.6
324 0.56
325 0.49
326 0.41
327 0.36
328 0.26
329 0.19
330 0.15
331 0.09
332 0.07
333 0.05
334 0.06
335 0.07
336 0.08
337 0.09
338 0.09
339 0.11
340 0.12
341 0.13
342 0.11
343 0.12
344 0.11
345 0.14
346 0.17
347 0.19
348 0.2
349 0.22
350 0.23
351 0.23
352 0.22
353 0.21
354 0.18
355 0.15
356 0.13
357 0.11
358 0.1
359 0.09
360 0.09
361 0.07
362 0.06
363 0.05
364 0.05
365 0.05
366 0.06
367 0.06
368 0.06
369 0.07
370 0.09
371 0.1
372 0.11
373 0.12
374 0.14
375 0.19
376 0.24
377 0.3
378 0.33
379 0.4
380 0.47
381 0.52
382 0.52
383 0.49
384 0.45
385 0.46
386 0.51
387 0.54
388 0.57
389 0.61
390 0.68
391 0.76
392 0.81
393 0.8
394 0.81
395 0.82
396 0.83
397 0.84
398 0.85
399 0.85
400 0.91