Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4V1XVM1

Protein Details
Accession A0A4V1XVM1    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
13-34VPETLLKKRKSQEKARAEKAAEHydrophilic
NLS Segment(s)
PositionSequence
19-55KKRKSQEKARAEKAAESEKKKQANKEKRTVIFKRAEK
Subcellular Location(s) nucl 15.5, cyto_nucl 11.5, cyto 6.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036919  L30_ferredoxin-like_sf  
IPR016082  Ribosomal_L30_ferredoxin-like  
IPR012988  Ribosomal_L30_N  
IPR039699  Ribosomal_L7/L30  
Pfam View protein in Pfam  
PF00327  Ribosomal_L30  
PF08079  Ribosomal_L30_N  
Amino Acid Sequences MAPTVPTKDQVLVPETLLKKRKSQEKARAEKAAESEKKKQANKEKRTVIFKRAEKYVKEYRDAEREKVRLHRLAKQEGNFHVDAEHRLLFVIRIKGINKIAPKPRKILQLLRLLQINSGVFVRITKATAEMIKVVEPWVAYGYPNLKSVKELIYKREPWQVRHHLH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.29
3 0.35
4 0.39
5 0.38
6 0.42
7 0.49
8 0.57
9 0.59
10 0.67
11 0.7
12 0.74
13 0.82
14 0.82
15 0.81
16 0.73
17 0.67
18 0.61
19 0.61
20 0.57
21 0.53
22 0.54
23 0.54
24 0.61
25 0.61
26 0.66
27 0.67
28 0.7
29 0.73
30 0.74
31 0.76
32 0.75
33 0.8
34 0.75
35 0.72
36 0.7
37 0.66
38 0.6
39 0.59
40 0.57
41 0.49
42 0.52
43 0.53
44 0.47
45 0.46
46 0.45
47 0.42
48 0.47
49 0.48
50 0.45
51 0.43
52 0.42
53 0.4
54 0.44
55 0.44
56 0.41
57 0.41
58 0.43
59 0.43
60 0.47
61 0.49
62 0.45
63 0.44
64 0.39
65 0.41
66 0.34
67 0.28
68 0.22
69 0.18
70 0.17
71 0.15
72 0.13
73 0.08
74 0.08
75 0.08
76 0.08
77 0.11
78 0.11
79 0.1
80 0.12
81 0.13
82 0.16
83 0.18
84 0.21
85 0.21
86 0.26
87 0.35
88 0.4
89 0.42
90 0.43
91 0.46
92 0.5
93 0.51
94 0.52
95 0.5
96 0.53
97 0.52
98 0.5
99 0.48
100 0.4
101 0.36
102 0.31
103 0.23
104 0.14
105 0.12
106 0.11
107 0.08
108 0.08
109 0.1
110 0.09
111 0.09
112 0.09
113 0.1
114 0.12
115 0.13
116 0.14
117 0.13
118 0.13
119 0.13
120 0.13
121 0.12
122 0.11
123 0.1
124 0.1
125 0.1
126 0.1
127 0.1
128 0.13
129 0.16
130 0.17
131 0.21
132 0.22
133 0.21
134 0.22
135 0.25
136 0.29
137 0.34
138 0.35
139 0.38
140 0.46
141 0.5
142 0.53
143 0.6
144 0.57
145 0.54
146 0.61