Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2M1E1

Protein Details
Accession E2M1E1    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
41-62RDYHRDRDRDHRRDRDRERDPYBasic
NLS Segment(s)
Subcellular Location(s) nucl 20, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
KEGG mpr:MPER_13612  -  
Amino Acid Sequences MAVEFEWTTLLPTVLMRQRPANTWAIVGSVTTYSRDRDRDRDYHRDRDRDHRRDRDRERDPYGRDSRDWRERRSPAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.22
3 0.22
4 0.27
5 0.28
6 0.31
7 0.35
8 0.32
9 0.28
10 0.26
11 0.24
12 0.19
13 0.17
14 0.14
15 0.1
16 0.07
17 0.07
18 0.08
19 0.09
20 0.1
21 0.13
22 0.18
23 0.2
24 0.25
25 0.31
26 0.37
27 0.42
28 0.52
29 0.54
30 0.6
31 0.64
32 0.64
33 0.62
34 0.65
35 0.7
36 0.69
37 0.73
38 0.73
39 0.75
40 0.78
41 0.84
42 0.83
43 0.81
44 0.79
45 0.78
46 0.75
47 0.71
48 0.7
49 0.7
50 0.63
51 0.58
52 0.57
53 0.58
54 0.61
55 0.63
56 0.61
57 0.63