Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4V1XW65

Protein Details
Accession A0A4V1XW65    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
286-305AEISRKRERKAKARELAARFHydrophilic
NLS Segment(s)
PositionSequence
290-299RKRERKAKAR
Subcellular Location(s) nucl 13, mito 13, mito_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR017907  Znf_RING_CS  
Gene Ontology GO:0046872  F:metal ion binding  
PROSITE View protein in PROSITE  
PS00518  ZF_RING_1  
Amino Acid Sequences MTPSGYSQAARMLERNLAVSPKRPDISQHSGTSTVGISRDRPRPLYVSKTSPFETPPPSPLELQGPVELQGPVELQGPVELQGPVELQGPVELQGPVGLQREESQRKRANHQQLHPSSSSAAAAAATPSARRGMRRLACGHFYCRDCLRRLIAAQLDAGNPAPECCHDEPVSHRDVRWADRGGPLLARLKAVRDHDGASRGSRPGIRRPAPTNNTASAAAFRERNARDGSDNLDMIYRETGAGAVTICFFCGAAIECAARPGCDDVHGGPEQAVQKFAPQWILAGAEISRKRERKAKARELAARFAIPGQPTPSAVPPAAPGSTRPMTGSAAVDKVPDFAYHFSGLRPEDSNPTPPRPD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.27
3 0.23
4 0.26
5 0.27
6 0.32
7 0.35
8 0.39
9 0.39
10 0.38
11 0.42
12 0.45
13 0.51
14 0.51
15 0.48
16 0.44
17 0.44
18 0.44
19 0.39
20 0.31
21 0.24
22 0.2
23 0.18
24 0.2
25 0.26
26 0.33
27 0.36
28 0.39
29 0.4
30 0.44
31 0.48
32 0.52
33 0.51
34 0.52
35 0.51
36 0.53
37 0.51
38 0.48
39 0.45
40 0.41
41 0.41
42 0.36
43 0.36
44 0.36
45 0.36
46 0.35
47 0.33
48 0.33
49 0.29
50 0.28
51 0.26
52 0.22
53 0.21
54 0.21
55 0.19
56 0.14
57 0.12
58 0.1
59 0.09
60 0.1
61 0.09
62 0.08
63 0.09
64 0.09
65 0.09
66 0.1
67 0.09
68 0.08
69 0.09
70 0.09
71 0.09
72 0.1
73 0.09
74 0.08
75 0.09
76 0.09
77 0.09
78 0.1
79 0.09
80 0.08
81 0.08
82 0.08
83 0.1
84 0.11
85 0.1
86 0.09
87 0.12
88 0.21
89 0.3
90 0.33
91 0.4
92 0.46
93 0.49
94 0.56
95 0.63
96 0.65
97 0.64
98 0.68
99 0.69
100 0.66
101 0.68
102 0.61
103 0.52
104 0.42
105 0.34
106 0.28
107 0.17
108 0.12
109 0.07
110 0.07
111 0.06
112 0.06
113 0.05
114 0.05
115 0.06
116 0.09
117 0.1
118 0.11
119 0.14
120 0.23
121 0.27
122 0.33
123 0.37
124 0.37
125 0.42
126 0.42
127 0.43
128 0.39
129 0.36
130 0.34
131 0.34
132 0.35
133 0.32
134 0.33
135 0.31
136 0.28
137 0.27
138 0.29
139 0.25
140 0.21
141 0.2
142 0.18
143 0.15
144 0.13
145 0.13
146 0.09
147 0.07
148 0.07
149 0.06
150 0.06
151 0.11
152 0.11
153 0.14
154 0.14
155 0.16
156 0.2
157 0.23
158 0.26
159 0.22
160 0.21
161 0.22
162 0.23
163 0.25
164 0.26
165 0.24
166 0.21
167 0.23
168 0.25
169 0.21
170 0.19
171 0.18
172 0.17
173 0.16
174 0.15
175 0.13
176 0.13
177 0.16
178 0.18
179 0.2
180 0.17
181 0.18
182 0.19
183 0.22
184 0.22
185 0.2
186 0.2
187 0.17
188 0.17
189 0.19
190 0.2
191 0.25
192 0.33
193 0.36
194 0.38
195 0.43
196 0.52
197 0.52
198 0.54
199 0.49
200 0.41
201 0.4
202 0.35
203 0.3
204 0.22
205 0.2
206 0.17
207 0.15
208 0.14
209 0.19
210 0.19
211 0.22
212 0.22
213 0.22
214 0.22
215 0.23
216 0.26
217 0.21
218 0.2
219 0.17
220 0.17
221 0.15
222 0.14
223 0.13
224 0.1
225 0.07
226 0.07
227 0.07
228 0.05
229 0.06
230 0.05
231 0.05
232 0.06
233 0.06
234 0.06
235 0.05
236 0.05
237 0.05
238 0.05
239 0.07
240 0.07
241 0.08
242 0.08
243 0.08
244 0.11
245 0.11
246 0.1
247 0.1
248 0.11
249 0.1
250 0.11
251 0.13
252 0.11
253 0.16
254 0.17
255 0.16
256 0.14
257 0.18
258 0.2
259 0.19
260 0.19
261 0.14
262 0.16
263 0.18
264 0.19
265 0.18
266 0.14
267 0.14
268 0.13
269 0.15
270 0.12
271 0.11
272 0.11
273 0.15
274 0.18
275 0.23
276 0.3
277 0.32
278 0.36
279 0.42
280 0.51
281 0.54
282 0.63
283 0.68
284 0.69
285 0.75
286 0.8
287 0.78
288 0.75
289 0.67
290 0.57
291 0.47
292 0.4
293 0.35
294 0.27
295 0.25
296 0.22
297 0.2
298 0.21
299 0.23
300 0.24
301 0.24
302 0.22
303 0.2
304 0.19
305 0.21
306 0.21
307 0.19
308 0.18
309 0.22
310 0.24
311 0.24
312 0.23
313 0.22
314 0.22
315 0.24
316 0.25
317 0.21
318 0.21
319 0.2
320 0.2
321 0.18
322 0.18
323 0.17
324 0.15
325 0.15
326 0.15
327 0.19
328 0.2
329 0.21
330 0.2
331 0.24
332 0.25
333 0.25
334 0.25
335 0.24
336 0.29
337 0.32
338 0.4
339 0.41