Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4ZS35

Protein Details
Accession A0A4Q4ZS35    Localization Confidence High Confidence Score 17.1
NoLS Segment(s)
PositionSequenceProtein Nature
303-325KASRASAARRRARGRGRGKRGRKBasic
NLS Segment(s)
PositionSequence
201-205RKRKR
246-257RGARSQKRAAAK
304-325ASRASAARRRARGRGRGKRGRK
Subcellular Location(s) nucl 17.5, cyto_nucl 11, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR012423  Eaf7/MRGBP  
Gene Ontology GO:0043189  C:H4/H2A histone acetyltransferase complex  
GO:0005634  C:nucleus  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF07904  Eaf7  
Amino Acid Sequences MPPKRKARSSLATASTPKTPTPLRDEDSMDIDTPQAADTPRGAGTPATPGATTTAASNKHNYPPDSEILNNLWTADQESSLFKAIIRWKPTGMHKHFRMLAISEHLRNHGFDPDIETHTRIPRIWEKLRTQYHLDIIDERDNIYRHEGEGLPFEEIYKDFELPADEFHDSMFARRLARPSDPPSSPAEWDADAPPGAAATRKRKRAGGDASSVGSSNAAKTRRPSTVGDTDQETPVPSSPVPRSARGARSQKRAAAKAKAESAEPEESEEEEDEDGDEEEDDGEEEDEGEEESEAEETGPATKASRASAARRRARGRGRGKRGRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.55
3 0.48
4 0.4
5 0.37
6 0.36
7 0.35
8 0.39
9 0.44
10 0.42
11 0.44
12 0.48
13 0.45
14 0.45
15 0.42
16 0.34
17 0.27
18 0.23
19 0.19
20 0.15
21 0.13
22 0.11
23 0.1
24 0.1
25 0.11
26 0.13
27 0.13
28 0.13
29 0.13
30 0.12
31 0.12
32 0.16
33 0.16
34 0.15
35 0.15
36 0.15
37 0.16
38 0.17
39 0.16
40 0.12
41 0.16
42 0.18
43 0.21
44 0.25
45 0.26
46 0.33
47 0.38
48 0.38
49 0.37
50 0.38
51 0.39
52 0.38
53 0.34
54 0.31
55 0.27
56 0.27
57 0.22
58 0.18
59 0.15
60 0.12
61 0.13
62 0.11
63 0.09
64 0.09
65 0.11
66 0.12
67 0.13
68 0.13
69 0.11
70 0.16
71 0.24
72 0.29
73 0.32
74 0.32
75 0.32
76 0.38
77 0.46
78 0.51
79 0.5
80 0.53
81 0.51
82 0.56
83 0.57
84 0.53
85 0.47
86 0.38
87 0.32
88 0.29
89 0.3
90 0.26
91 0.24
92 0.24
93 0.23
94 0.23
95 0.22
96 0.18
97 0.16
98 0.14
99 0.18
100 0.19
101 0.21
102 0.21
103 0.22
104 0.21
105 0.23
106 0.25
107 0.2
108 0.22
109 0.26
110 0.33
111 0.37
112 0.41
113 0.43
114 0.51
115 0.55
116 0.54
117 0.51
118 0.45
119 0.43
120 0.38
121 0.34
122 0.27
123 0.25
124 0.24
125 0.2
126 0.19
127 0.18
128 0.17
129 0.16
130 0.17
131 0.15
132 0.12
133 0.14
134 0.14
135 0.12
136 0.14
137 0.14
138 0.12
139 0.11
140 0.11
141 0.09
142 0.09
143 0.11
144 0.09
145 0.09
146 0.08
147 0.09
148 0.1
149 0.09
150 0.1
151 0.09
152 0.08
153 0.08
154 0.08
155 0.1
156 0.08
157 0.09
158 0.11
159 0.1
160 0.12
161 0.13
162 0.16
163 0.17
164 0.2
165 0.24
166 0.27
167 0.31
168 0.3
169 0.31
170 0.33
171 0.32
172 0.3
173 0.25
174 0.22
175 0.17
176 0.17
177 0.16
178 0.13
179 0.11
180 0.1
181 0.08
182 0.07
183 0.07
184 0.08
185 0.12
186 0.22
187 0.29
188 0.35
189 0.38
190 0.41
191 0.44
192 0.5
193 0.54
194 0.48
195 0.46
196 0.41
197 0.4
198 0.37
199 0.34
200 0.25
201 0.17
202 0.12
203 0.09
204 0.13
205 0.13
206 0.15
207 0.18
208 0.23
209 0.26
210 0.29
211 0.3
212 0.32
213 0.4
214 0.41
215 0.39
216 0.38
217 0.37
218 0.34
219 0.31
220 0.25
221 0.17
222 0.15
223 0.15
224 0.12
225 0.15
226 0.16
227 0.25
228 0.27
229 0.29
230 0.33
231 0.38
232 0.44
233 0.48
234 0.57
235 0.55
236 0.61
237 0.63
238 0.64
239 0.65
240 0.66
241 0.63
242 0.61
243 0.59
244 0.55
245 0.55
246 0.51
247 0.44
248 0.39
249 0.38
250 0.32
251 0.28
252 0.25
253 0.21
254 0.2
255 0.21
256 0.19
257 0.15
258 0.12
259 0.12
260 0.09
261 0.09
262 0.09
263 0.08
264 0.07
265 0.06
266 0.06
267 0.06
268 0.06
269 0.06
270 0.06
271 0.06
272 0.06
273 0.06
274 0.06
275 0.06
276 0.06
277 0.06
278 0.05
279 0.06
280 0.06
281 0.06
282 0.06
283 0.06
284 0.06
285 0.08
286 0.09
287 0.09
288 0.1
289 0.13
290 0.14
291 0.16
292 0.23
293 0.26
294 0.34
295 0.43
296 0.52
297 0.58
298 0.65
299 0.7
300 0.72
301 0.78
302 0.79
303 0.81
304 0.82
305 0.84