Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G9N6E0

Protein Details
Accession G9N6E0    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
320-345LAGLAGKKKPPPPPPKKKPSLSAAAPHydrophilic
NLS Segment(s)
PositionSequence
14-38SGREKASEYKGKAKGKVTKHIPGRG
325-339GKKKPPPPPPKKKPS
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MSKYAEMAKGKLSSGREKASEYKGKAKGKVTKHIPGRGHKDDHDAPTHVARPLNSLRDPNSFAPPPKRTGSGLAPPPPPSSAKRSVVTAPSKYQDPHGPKVEPPPRFADESQLEAYEAEQEAHPVSSGPYRVNTTGLSTDHLPPPPVRRDAAGSRSPPSYDSVVGAGPGDTKAPSLPPRLPPRSGSGTPDRTASPLSTLGVSSSNLNQGAVNRLGAAGINVPAFGIGSSSPSHADDETPPPKPPRPNATPPSQLNELQNRFARLGTSNTGSSTGPPTPPSEVTTAATATATTWAQKQAAIKAASPVPSPSPTGSTGSSGLAGLAGKKKPPPPPPKKKPSLSAAAPPAGNGGAPPPIPMSTRPSY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.44
3 0.41
4 0.43
5 0.49
6 0.53
7 0.57
8 0.53
9 0.57
10 0.6
11 0.65
12 0.67
13 0.69
14 0.68
15 0.67
16 0.72
17 0.7
18 0.7
19 0.72
20 0.74
21 0.73
22 0.74
23 0.75
24 0.73
25 0.71
26 0.64
27 0.64
28 0.62
29 0.6
30 0.55
31 0.49
32 0.43
33 0.43
34 0.44
35 0.38
36 0.34
37 0.29
38 0.31
39 0.34
40 0.38
41 0.36
42 0.37
43 0.38
44 0.41
45 0.45
46 0.41
47 0.43
48 0.41
49 0.44
50 0.48
51 0.49
52 0.48
53 0.46
54 0.47
55 0.41
56 0.42
57 0.43
58 0.42
59 0.46
60 0.47
61 0.47
62 0.47
63 0.46
64 0.43
65 0.4
66 0.35
67 0.35
68 0.37
69 0.39
70 0.38
71 0.4
72 0.42
73 0.47
74 0.49
75 0.45
76 0.41
77 0.38
78 0.4
79 0.37
80 0.37
81 0.37
82 0.38
83 0.41
84 0.42
85 0.42
86 0.41
87 0.51
88 0.54
89 0.48
90 0.45
91 0.44
92 0.41
93 0.43
94 0.41
95 0.39
96 0.33
97 0.35
98 0.33
99 0.27
100 0.24
101 0.2
102 0.2
103 0.14
104 0.12
105 0.09
106 0.08
107 0.08
108 0.08
109 0.08
110 0.08
111 0.06
112 0.07
113 0.09
114 0.1
115 0.1
116 0.12
117 0.14
118 0.15
119 0.16
120 0.15
121 0.15
122 0.16
123 0.16
124 0.16
125 0.16
126 0.18
127 0.2
128 0.2
129 0.19
130 0.18
131 0.24
132 0.27
133 0.27
134 0.25
135 0.23
136 0.27
137 0.3
138 0.35
139 0.34
140 0.31
141 0.31
142 0.31
143 0.31
144 0.27
145 0.24
146 0.2
147 0.15
148 0.13
149 0.12
150 0.11
151 0.11
152 0.1
153 0.07
154 0.06
155 0.06
156 0.05
157 0.04
158 0.05
159 0.05
160 0.07
161 0.1
162 0.13
163 0.16
164 0.23
165 0.32
166 0.36
167 0.37
168 0.36
169 0.39
170 0.42
171 0.4
172 0.37
173 0.36
174 0.36
175 0.35
176 0.34
177 0.3
178 0.24
179 0.24
180 0.19
181 0.14
182 0.11
183 0.11
184 0.09
185 0.09
186 0.09
187 0.09
188 0.09
189 0.08
190 0.08
191 0.1
192 0.09
193 0.1
194 0.09
195 0.09
196 0.13
197 0.12
198 0.11
199 0.09
200 0.09
201 0.09
202 0.08
203 0.08
204 0.05
205 0.05
206 0.05
207 0.05
208 0.05
209 0.05
210 0.05
211 0.04
212 0.04
213 0.03
214 0.05
215 0.06
216 0.07
217 0.08
218 0.09
219 0.1
220 0.1
221 0.12
222 0.13
223 0.2
224 0.24
225 0.25
226 0.27
227 0.3
228 0.35
229 0.4
230 0.43
231 0.45
232 0.49
233 0.56
234 0.59
235 0.62
236 0.65
237 0.61
238 0.6
239 0.54
240 0.49
241 0.44
242 0.48
243 0.43
244 0.4
245 0.41
246 0.37
247 0.34
248 0.32
249 0.28
250 0.21
251 0.22
252 0.2
253 0.2
254 0.19
255 0.19
256 0.21
257 0.19
258 0.18
259 0.19
260 0.18
261 0.17
262 0.18
263 0.19
264 0.21
265 0.22
266 0.24
267 0.22
268 0.21
269 0.21
270 0.21
271 0.19
272 0.16
273 0.14
274 0.12
275 0.1
276 0.1
277 0.09
278 0.09
279 0.11
280 0.13
281 0.13
282 0.16
283 0.18
284 0.2
285 0.27
286 0.27
287 0.26
288 0.28
289 0.3
290 0.3
291 0.28
292 0.26
293 0.22
294 0.23
295 0.25
296 0.22
297 0.22
298 0.23
299 0.25
300 0.24
301 0.23
302 0.22
303 0.2
304 0.19
305 0.16
306 0.14
307 0.11
308 0.11
309 0.12
310 0.16
311 0.18
312 0.2
313 0.26
314 0.33
315 0.41
316 0.51
317 0.59
318 0.64
319 0.74
320 0.82
321 0.88
322 0.91
323 0.9
324 0.88
325 0.84
326 0.83
327 0.76
328 0.74
329 0.7
330 0.64
331 0.56
332 0.48
333 0.41
334 0.32
335 0.26
336 0.17
337 0.13
338 0.12
339 0.12
340 0.13
341 0.14
342 0.16
343 0.18
344 0.21