Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4ZU52

Protein Details
Accession A0A4Q4ZU52   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
77-104RQEGRHVRQPRQARRRRHQDLRHVEPGGBasic
NLS Segment(s)
PositionSequence
87-93RQARRRR
Subcellular Location(s) nucl 13.5, cyto_nucl 12, cyto 7.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR018392  LysM_dom  
IPR036779  LysM_dom_sf  
CDD cd00118  LysM  
Amino Acid Sequences MTTNCNKSYKVKSGDGCAAIAQNNGISLSNYYVYVRTVGFQLTETTQKLTKTGGNGAQTPTPTQTGMVGQLRHVLLRQEGRHVRQPRQARRRRHQDLRHVEPGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.53
3 0.45
4 0.37
5 0.31
6 0.25
7 0.22
8 0.16
9 0.1
10 0.09
11 0.09
12 0.08
13 0.07
14 0.07
15 0.09
16 0.09
17 0.1
18 0.1
19 0.1
20 0.1
21 0.1
22 0.1
23 0.09
24 0.09
25 0.08
26 0.08
27 0.08
28 0.09
29 0.09
30 0.12
31 0.12
32 0.13
33 0.14
34 0.14
35 0.14
36 0.14
37 0.14
38 0.13
39 0.16
40 0.17
41 0.17
42 0.18
43 0.19
44 0.19
45 0.18
46 0.18
47 0.16
48 0.14
49 0.12
50 0.11
51 0.1
52 0.09
53 0.13
54 0.16
55 0.15
56 0.14
57 0.18
58 0.18
59 0.17
60 0.17
61 0.14
62 0.15
63 0.21
64 0.22
65 0.27
66 0.33
67 0.37
68 0.46
69 0.5
70 0.53
71 0.55
72 0.64
73 0.66
74 0.72
75 0.76
76 0.78
77 0.83
78 0.88
79 0.9
80 0.9
81 0.89
82 0.89
83 0.91
84 0.89