Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LUC8

Protein Details
Accession E2LUC8   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
105-128EEVARKKKGAKSKASPRKPKAGANBasic
NLS Segment(s)
PositionSequence
109-126RKKKGAKSKASPRKPKAG
Subcellular Location(s) nucl 16.5, cyto_nucl 12, cyto 6.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR003616  Post-SET_dom  
IPR001214  SET_dom  
IPR046341  SET_dom_sf  
Gene Ontology GO:0005694  C:chromosome  
GO:0016740  F:transferase activity  
KEGG mpr:MPER_10747  -  
Pfam View protein in Pfam  
PF00856  SET  
PROSITE View protein in PROSITE  
PS50868  POST_SET  
PS50280  SET  
Amino Acid Sequences GKYYSMTNLKSGDSYDKFGRTYLFDLNMYYLDNDCKYTIDAYHAGNFTRFLNHSCDPNAMLSFVYIDEADIYKPLLCIFARRDITPNEEITFSYAGDPDVDDDEEEVARKKKGAKSKASPRKPKAGANVHKPCRCGAKNCKGVMWR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.31
3 0.33
4 0.32
5 0.32
6 0.31
7 0.26
8 0.26
9 0.25
10 0.24
11 0.22
12 0.22
13 0.22
14 0.21
15 0.18
16 0.16
17 0.13
18 0.12
19 0.13
20 0.13
21 0.12
22 0.13
23 0.13
24 0.13
25 0.12
26 0.14
27 0.15
28 0.16
29 0.19
30 0.19
31 0.18
32 0.18
33 0.18
34 0.15
35 0.16
36 0.15
37 0.13
38 0.19
39 0.19
40 0.21
41 0.21
42 0.22
43 0.2
44 0.2
45 0.18
46 0.12
47 0.11
48 0.09
49 0.08
50 0.07
51 0.06
52 0.05
53 0.04
54 0.04
55 0.05
56 0.05
57 0.05
58 0.05
59 0.05
60 0.05
61 0.05
62 0.06
63 0.06
64 0.09
65 0.11
66 0.18
67 0.2
68 0.2
69 0.23
70 0.22
71 0.27
72 0.27
73 0.26
74 0.19
75 0.19
76 0.18
77 0.18
78 0.17
79 0.12
80 0.1
81 0.09
82 0.08
83 0.08
84 0.08
85 0.07
86 0.08
87 0.08
88 0.07
89 0.07
90 0.08
91 0.08
92 0.08
93 0.1
94 0.11
95 0.11
96 0.14
97 0.2
98 0.25
99 0.35
100 0.43
101 0.5
102 0.58
103 0.69
104 0.78
105 0.83
106 0.87
107 0.84
108 0.86
109 0.81
110 0.77
111 0.76
112 0.76
113 0.74
114 0.74
115 0.79
116 0.78
117 0.76
118 0.71
119 0.64
120 0.63
121 0.59
122 0.58
123 0.59
124 0.6
125 0.65
126 0.66