Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q4ZW22

Protein Details
Accession A0A4Q4ZW22    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
90-116DIQPQPTAVRLRRRQKKRRTPAETDPVHydrophilic
NLS Segment(s)
PositionSequence
100-108LRRRQKKRR
Subcellular Location(s) nucl 17, mito 5, cyto 4
Family & Domain DBs
Amino Acid Sequences MSALHPLAVAAAACMRDTSDASIPSESPTRADLRWPCPNLPSRRATKPRSSGGATFTPPCVRFTSMGSVESREGAFLQEPQSQGVEHLRDIQPQPTAVRLRRRQKKRRTPAETDPV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.09
4 0.1
5 0.13
6 0.15
7 0.16
8 0.18
9 0.19
10 0.19
11 0.2
12 0.22
13 0.19
14 0.16
15 0.17
16 0.18
17 0.17
18 0.24
19 0.28
20 0.31
21 0.4
22 0.42
23 0.4
24 0.43
25 0.51
26 0.5
27 0.5
28 0.49
29 0.46
30 0.53
31 0.6
32 0.61
33 0.61
34 0.61
35 0.59
36 0.58
37 0.54
38 0.46
39 0.42
40 0.39
41 0.32
42 0.26
43 0.23
44 0.22
45 0.2
46 0.2
47 0.18
48 0.16
49 0.16
50 0.17
51 0.21
52 0.2
53 0.21
54 0.2
55 0.19
56 0.18
57 0.18
58 0.16
59 0.1
60 0.09
61 0.08
62 0.08
63 0.08
64 0.11
65 0.13
66 0.14
67 0.14
68 0.15
69 0.14
70 0.15
71 0.18
72 0.16
73 0.14
74 0.19
75 0.2
76 0.23
77 0.25
78 0.26
79 0.24
80 0.24
81 0.25
82 0.25
83 0.31
84 0.33
85 0.42
86 0.49
87 0.59
88 0.67
89 0.78
90 0.82
91 0.86
92 0.91
93 0.92
94 0.94
95 0.92
96 0.9