Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4XFB6

Protein Details
Accession A0A4Q4XFB6    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
81-102CTECKRCPKGQMPDKTQKRCLPHydrophilic
126-166KAEYKAKRYEIKRQDKRRIYHDKRNEEKRRKVRRMGRCLALBasic
NLS Segment(s)
PositionSequence
114-160KERKFQEKIPQKKAEYKAKRYEIKRQDKRRIYHDKRNEEKRRKVRRM
323-335IAKGRGSKKTKSE
Subcellular Location(s) mito 14.5, mito_nucl 12.166, cyto_mito 10.333, nucl 8.5
Family & Domain DBs
Amino Acid Sequences MRLSKTSKALLLILNHLAAAHVPRDMATARLHGPGQGKNSLAARYASMETFDPESHLFGRQACDGCRKRCSPGKIIDPRDCTECKRCPKGQMPDKTQKRCLPNPHDQDRKNQDKERKFQEKIPQKKAEYKAKRYEIKRQDKRRIYHDKRNEEKRRKVRRMGRCLALVPLSMGAQVATEYSDEFFDEQFLEDMELMEFWPEGMQIDAWNDNKSDDIFENDDYVNKWIVVGEAVSKRAVDTNASQAELELIASHPAPHEDTSTKTARIFTSDVVAFPTAATDLTVRGELQARCPICFLIPIFTAAIRTATAVARLVRLTRTAIRIAKGRGSKKTKSEQREGADRIAKDQRWRRCLAKMDP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.24
3 0.21
4 0.18
5 0.15
6 0.14
7 0.11
8 0.09
9 0.09
10 0.1
11 0.12
12 0.13
13 0.14
14 0.14
15 0.17
16 0.18
17 0.22
18 0.22
19 0.23
20 0.27
21 0.29
22 0.32
23 0.32
24 0.3
25 0.3
26 0.33
27 0.3
28 0.28
29 0.24
30 0.21
31 0.21
32 0.22
33 0.19
34 0.18
35 0.17
36 0.17
37 0.19
38 0.18
39 0.16
40 0.15
41 0.17
42 0.17
43 0.19
44 0.18
45 0.17
46 0.2
47 0.22
48 0.24
49 0.25
50 0.34
51 0.39
52 0.43
53 0.48
54 0.48
55 0.51
56 0.57
57 0.61
58 0.59
59 0.6
60 0.65
61 0.68
62 0.73
63 0.73
64 0.7
65 0.65
66 0.62
67 0.56
68 0.51
69 0.49
70 0.5
71 0.52
72 0.55
73 0.57
74 0.6
75 0.67
76 0.73
77 0.74
78 0.75
79 0.75
80 0.78
81 0.84
82 0.82
83 0.8
84 0.76
85 0.74
86 0.72
87 0.73
88 0.7
89 0.71
90 0.74
91 0.75
92 0.78
93 0.72
94 0.74
95 0.74
96 0.75
97 0.72
98 0.7
99 0.7
100 0.69
101 0.75
102 0.75
103 0.75
104 0.68
105 0.67
106 0.7
107 0.71
108 0.72
109 0.74
110 0.72
111 0.65
112 0.72
113 0.73
114 0.74
115 0.73
116 0.72
117 0.71
118 0.72
119 0.76
120 0.71
121 0.74
122 0.74
123 0.76
124 0.77
125 0.78
126 0.8
127 0.8
128 0.81
129 0.8
130 0.81
131 0.78
132 0.78
133 0.78
134 0.77
135 0.78
136 0.85
137 0.86
138 0.84
139 0.86
140 0.87
141 0.88
142 0.85
143 0.86
144 0.85
145 0.85
146 0.85
147 0.8
148 0.73
149 0.64
150 0.57
151 0.49
152 0.4
153 0.29
154 0.19
155 0.13
156 0.09
157 0.07
158 0.06
159 0.05
160 0.04
161 0.04
162 0.03
163 0.03
164 0.03
165 0.04
166 0.04
167 0.04
168 0.04
169 0.05
170 0.05
171 0.05
172 0.05
173 0.05
174 0.05
175 0.05
176 0.05
177 0.05
178 0.05
179 0.05
180 0.04
181 0.04
182 0.04
183 0.04
184 0.03
185 0.03
186 0.03
187 0.03
188 0.03
189 0.03
190 0.04
191 0.05
192 0.08
193 0.09
194 0.1
195 0.1
196 0.1
197 0.11
198 0.11
199 0.11
200 0.09
201 0.11
202 0.12
203 0.12
204 0.14
205 0.13
206 0.14
207 0.13
208 0.14
209 0.12
210 0.1
211 0.09
212 0.07
213 0.08
214 0.07
215 0.06
216 0.09
217 0.1
218 0.12
219 0.12
220 0.12
221 0.12
222 0.14
223 0.14
224 0.12
225 0.12
226 0.18
227 0.19
228 0.2
229 0.2
230 0.17
231 0.17
232 0.15
233 0.13
234 0.06
235 0.05
236 0.06
237 0.06
238 0.06
239 0.06
240 0.07
241 0.09
242 0.09
243 0.12
244 0.13
245 0.16
246 0.21
247 0.24
248 0.24
249 0.24
250 0.26
251 0.23
252 0.26
253 0.24
254 0.19
255 0.22
256 0.21
257 0.2
258 0.19
259 0.19
260 0.15
261 0.13
262 0.13
263 0.08
264 0.07
265 0.08
266 0.06
267 0.06
268 0.07
269 0.08
270 0.08
271 0.09
272 0.15
273 0.15
274 0.19
275 0.26
276 0.25
277 0.25
278 0.26
279 0.25
280 0.2
281 0.23
282 0.2
283 0.16
284 0.16
285 0.17
286 0.17
287 0.17
288 0.17
289 0.14
290 0.14
291 0.1
292 0.1
293 0.1
294 0.1
295 0.11
296 0.13
297 0.13
298 0.15
299 0.16
300 0.17
301 0.16
302 0.18
303 0.21
304 0.23
305 0.26
306 0.31
307 0.34
308 0.35
309 0.4
310 0.42
311 0.46
312 0.49
313 0.52
314 0.55
315 0.6
316 0.63
317 0.66
318 0.73
319 0.75
320 0.76
321 0.79
322 0.77
323 0.76
324 0.79
325 0.74
326 0.71
327 0.68
328 0.6
329 0.57
330 0.57
331 0.54
332 0.54
333 0.59
334 0.61
335 0.61
336 0.67
337 0.65
338 0.64