Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q4VNY7

Protein Details
Accession A0A4Q4VNY7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
53-72KGTSCRTQKRRASSRDAVRSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, extr 9, cyto 2
Family & Domain DBs
Amino Acid Sequences MLIQTPGTLSTRTFRQVDVLRLISDSVFGLWSDAPRAARMKEQTSDGLQEWAKGTSCRTQKRRASSRDAVRSGTYLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.28
3 0.31
4 0.34
5 0.36
6 0.34
7 0.29
8 0.29
9 0.29
10 0.21
11 0.17
12 0.13
13 0.07
14 0.06
15 0.05
16 0.06
17 0.06
18 0.06
19 0.07
20 0.08
21 0.08
22 0.09
23 0.11
24 0.11
25 0.15
26 0.18
27 0.2
28 0.2
29 0.21
30 0.22
31 0.21
32 0.23
33 0.19
34 0.2
35 0.17
36 0.17
37 0.16
38 0.15
39 0.15
40 0.13
41 0.15
42 0.19
43 0.27
44 0.36
45 0.41
46 0.5
47 0.57
48 0.67
49 0.75
50 0.75
51 0.76
52 0.76
53 0.8
54 0.8
55 0.75
56 0.68
57 0.6