Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9N782

Protein Details
Accession G9N782   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
19-45IPNLKDRIPKLEPRRRRPGPSNPTPVPHydrophilic
NLS Segment(s)
PositionSequence
28-36KLEPRRRRP
Subcellular Location(s) nucl 11.5, cyto_nucl 11, cyto 9.5, plas 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR004327  Phstyr_phstse_ac  
IPR043170  PTPA_C_lid  
IPR037218  PTPA_sf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0003755  F:peptidyl-prolyl cis-trans isomerase activity  
GO:0019211  F:phosphatase activator activity  
Pfam View protein in Pfam  
PF03095  PTPA  
CDD cd04087  PTPA  
Amino Acid Sequences MASESPAQPVSSPSLASGIPNLKDRIPKLEPRRRRPGPSNPTPVPQTPALPSPPDLTDWSFKLPSRRILSKEDHDLFLASPTYNLIVAWVFGLSESVVDTPKSAVRDESLSQGAKTILSILDQAEAFVSQSPPNEQGGCRFGNKAFRGFLDLVKEKTTAWHESLGLHNADAIAEASAYFVQSFGNRNRIDYGSGHELNFMMWLLCLYQLGILQRSDFQALVLRVFVRYLSLMRVVQMAYYLEPAGSHGVWGLDDYQFLPFLFGASQLLHHPYITPRGIHQDLTVEEFGDDYLYLGQVNFVNSTKTVKGLRWHSPMLDDISSSKSWTKIDGGMRRMFVAEVLGKLPVMQHFLFGSLISAAAGMSEEDPSAAGEDSGEDQSNNSHTGHAHDGTGWGDCCGIKVPSALAAAQEMKKGGHVETLRRIPFD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.19
4 0.22
5 0.22
6 0.24
7 0.28
8 0.3
9 0.31
10 0.38
11 0.39
12 0.42
13 0.43
14 0.5
15 0.57
16 0.65
17 0.72
18 0.75
19 0.84
20 0.83
21 0.86
22 0.86
23 0.86
24 0.86
25 0.85
26 0.86
27 0.78
28 0.76
29 0.72
30 0.64
31 0.58
32 0.5
33 0.42
34 0.36
35 0.37
36 0.34
37 0.31
38 0.31
39 0.29
40 0.28
41 0.27
42 0.27
43 0.26
44 0.27
45 0.27
46 0.3
47 0.3
48 0.31
49 0.37
50 0.39
51 0.44
52 0.47
53 0.51
54 0.51
55 0.55
56 0.6
57 0.58
58 0.63
59 0.57
60 0.51
61 0.45
62 0.42
63 0.35
64 0.3
65 0.25
66 0.14
67 0.12
68 0.11
69 0.11
70 0.1
71 0.09
72 0.08
73 0.07
74 0.07
75 0.07
76 0.06
77 0.05
78 0.05
79 0.06
80 0.04
81 0.04
82 0.05
83 0.05
84 0.06
85 0.07
86 0.07
87 0.09
88 0.11
89 0.13
90 0.13
91 0.13
92 0.14
93 0.18
94 0.18
95 0.21
96 0.23
97 0.22
98 0.21
99 0.22
100 0.2
101 0.16
102 0.15
103 0.12
104 0.08
105 0.08
106 0.09
107 0.08
108 0.09
109 0.09
110 0.09
111 0.08
112 0.08
113 0.08
114 0.08
115 0.09
116 0.08
117 0.09
118 0.11
119 0.13
120 0.15
121 0.16
122 0.15
123 0.17
124 0.2
125 0.21
126 0.21
127 0.21
128 0.21
129 0.29
130 0.3
131 0.29
132 0.27
133 0.25
134 0.29
135 0.28
136 0.27
137 0.26
138 0.27
139 0.25
140 0.25
141 0.25
142 0.2
143 0.22
144 0.24
145 0.2
146 0.19
147 0.2
148 0.19
149 0.2
150 0.22
151 0.21
152 0.18
153 0.14
154 0.13
155 0.11
156 0.1
157 0.09
158 0.07
159 0.04
160 0.03
161 0.04
162 0.04
163 0.04
164 0.04
165 0.04
166 0.04
167 0.04
168 0.05
169 0.1
170 0.12
171 0.2
172 0.2
173 0.21
174 0.23
175 0.24
176 0.24
177 0.21
178 0.23
179 0.22
180 0.23
181 0.22
182 0.2
183 0.19
184 0.17
185 0.16
186 0.12
187 0.05
188 0.04
189 0.04
190 0.04
191 0.04
192 0.04
193 0.03
194 0.04
195 0.05
196 0.06
197 0.07
198 0.07
199 0.07
200 0.08
201 0.09
202 0.09
203 0.08
204 0.08
205 0.1
206 0.1
207 0.1
208 0.1
209 0.1
210 0.09
211 0.09
212 0.09
213 0.05
214 0.06
215 0.06
216 0.07
217 0.09
218 0.09
219 0.09
220 0.1
221 0.09
222 0.09
223 0.09
224 0.08
225 0.06
226 0.07
227 0.06
228 0.05
229 0.05
230 0.06
231 0.07
232 0.06
233 0.06
234 0.05
235 0.06
236 0.06
237 0.06
238 0.07
239 0.05
240 0.06
241 0.06
242 0.06
243 0.07
244 0.07
245 0.07
246 0.06
247 0.06
248 0.06
249 0.06
250 0.06
251 0.06
252 0.07
253 0.07
254 0.1
255 0.1
256 0.1
257 0.11
258 0.11
259 0.17
260 0.17
261 0.17
262 0.16
263 0.22
264 0.24
265 0.23
266 0.22
267 0.2
268 0.19
269 0.22
270 0.21
271 0.15
272 0.13
273 0.13
274 0.12
275 0.09
276 0.08
277 0.04
278 0.05
279 0.04
280 0.05
281 0.04
282 0.06
283 0.07
284 0.07
285 0.09
286 0.09
287 0.1
288 0.1
289 0.14
290 0.13
291 0.16
292 0.17
293 0.18
294 0.25
295 0.31
296 0.38
297 0.4
298 0.42
299 0.39
300 0.39
301 0.38
302 0.35
303 0.28
304 0.21
305 0.17
306 0.19
307 0.19
308 0.19
309 0.18
310 0.17
311 0.17
312 0.18
313 0.19
314 0.22
315 0.3
316 0.35
317 0.4
318 0.41
319 0.41
320 0.4
321 0.38
322 0.31
323 0.23
324 0.19
325 0.15
326 0.12
327 0.12
328 0.12
329 0.11
330 0.11
331 0.12
332 0.11
333 0.14
334 0.13
335 0.13
336 0.13
337 0.15
338 0.15
339 0.13
340 0.13
341 0.08
342 0.08
343 0.06
344 0.06
345 0.05
346 0.04
347 0.05
348 0.04
349 0.05
350 0.05
351 0.05
352 0.05
353 0.06
354 0.06
355 0.07
356 0.07
357 0.06
358 0.06
359 0.07
360 0.09
361 0.11
362 0.12
363 0.1
364 0.11
365 0.13
366 0.15
367 0.16
368 0.14
369 0.14
370 0.14
371 0.18
372 0.23
373 0.22
374 0.21
375 0.19
376 0.2
377 0.2
378 0.22
379 0.18
380 0.13
381 0.13
382 0.12
383 0.13
384 0.15
385 0.14
386 0.12
387 0.13
388 0.14
389 0.16
390 0.18
391 0.17
392 0.14
393 0.17
394 0.21
395 0.22
396 0.23
397 0.2
398 0.19
399 0.22
400 0.23
401 0.2
402 0.23
403 0.26
404 0.31
405 0.4
406 0.48