Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q4U1W7

Protein Details
Accession A0A4Q4U1W7    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MESRLKVMRKRRGRSLHRKIVEYBasic
NLS Segment(s)
PositionSequence
9-16RKRRGRSL
Subcellular Location(s) nucl 20.5, cyto_nucl 11, mito 6
Family & Domain DBs
Amino Acid Sequences MESRLKVMRKRRGRSLHRKIVEYSDLFNLNITLIAQDKTSGDYEVFQPEPDENWPPAMRDIGRREKDMGESLRSELQRLEKLVKQSKVPKPPKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.88
3 0.88
4 0.83
5 0.79
6 0.71
7 0.66
8 0.61
9 0.51
10 0.42
11 0.35
12 0.31
13 0.27
14 0.25
15 0.19
16 0.13
17 0.12
18 0.09
19 0.06
20 0.06
21 0.06
22 0.06
23 0.07
24 0.07
25 0.08
26 0.09
27 0.09
28 0.08
29 0.08
30 0.1
31 0.12
32 0.12
33 0.1
34 0.1
35 0.1
36 0.11
37 0.12
38 0.13
39 0.1
40 0.13
41 0.13
42 0.14
43 0.15
44 0.16
45 0.15
46 0.19
47 0.26
48 0.34
49 0.36
50 0.37
51 0.39
52 0.38
53 0.39
54 0.39
55 0.35
56 0.28
57 0.26
58 0.27
59 0.3
60 0.29
61 0.27
62 0.24
63 0.26
64 0.27
65 0.28
66 0.31
67 0.29
68 0.39
69 0.47
70 0.47
71 0.5
72 0.56
73 0.63
74 0.69