Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q4VD44

Protein Details
Accession A0A4Q4VD44    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
3-28EYFLDTPRRQERKTRKKAGLPAKHDAHydrophilic
NLS Segment(s)
PositionSequence
11-21RQERKTRKKAG
Subcellular Location(s) nucl 13, cyto_nucl 12.5, cyto 10, mito 3
Family & Domain DBs
Amino Acid Sequences MQEYFLDTPRRQERKTRKKAGLPAKHDAVSGATNLVTLYVDDIEDICEYAGFKYIIPSDFFHPVLHETSSAIAGYRLALCEH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.79
3 0.8
4 0.78
5 0.79
6 0.86
7 0.87
8 0.85
9 0.8
10 0.76
11 0.69
12 0.61
13 0.53
14 0.43
15 0.34
16 0.25
17 0.18
18 0.12
19 0.08
20 0.07
21 0.07
22 0.07
23 0.05
24 0.04
25 0.04
26 0.04
27 0.04
28 0.04
29 0.04
30 0.05
31 0.04
32 0.05
33 0.04
34 0.04
35 0.04
36 0.05
37 0.07
38 0.07
39 0.07
40 0.09
41 0.11
42 0.12
43 0.14
44 0.16
45 0.17
46 0.2
47 0.21
48 0.19
49 0.19
50 0.19
51 0.19
52 0.19
53 0.16
54 0.13
55 0.13
56 0.14
57 0.12
58 0.1
59 0.09
60 0.08
61 0.09
62 0.1