Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4VNL3

Protein Details
Accession A0A4Q4VNL3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
59-83TSPDGTTTTRRRRSRRKAAEVKDGIHydrophilic
NLS Segment(s)
PositionSequence
68-76RRRRSRRKA
Subcellular Location(s) extr 10, mito 7, E.R. 3, plas 2, golg 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR031459  Coa2  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0033617  P:mitochondrial cytochrome c oxidase assembly  
Pfam View protein in Pfam  
PF17051  COA2  
Amino Acid Sequences MPPHLHPRSRMTSSLFATTVLASFFVVALPHVLPCPAPRVAYADSNSSSSTETETITVTSPDGTTTTRRRRSRRKAAEVKDGIAAFEGREEDFEEEQKEGRPRPRQERECPVPKPGGVIAELMGFRSDRPTGDGRPGAVGRGGGGGGGGGGEEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.42
3 0.34
4 0.3
5 0.27
6 0.21
7 0.14
8 0.12
9 0.07
10 0.07
11 0.06
12 0.06
13 0.06
14 0.05
15 0.07
16 0.07
17 0.07
18 0.07
19 0.07
20 0.08
21 0.08
22 0.13
23 0.12
24 0.13
25 0.13
26 0.18
27 0.2
28 0.24
29 0.24
30 0.24
31 0.24
32 0.24
33 0.24
34 0.2
35 0.19
36 0.14
37 0.15
38 0.12
39 0.11
40 0.1
41 0.1
42 0.1
43 0.1
44 0.1
45 0.08
46 0.07
47 0.07
48 0.07
49 0.07
50 0.08
51 0.12
52 0.21
53 0.3
54 0.39
55 0.47
56 0.55
57 0.65
58 0.75
59 0.81
60 0.83
61 0.84
62 0.85
63 0.83
64 0.84
65 0.75
66 0.65
67 0.57
68 0.46
69 0.35
70 0.25
71 0.2
72 0.09
73 0.09
74 0.08
75 0.05
76 0.06
77 0.07
78 0.09
79 0.09
80 0.1
81 0.11
82 0.11
83 0.12
84 0.15
85 0.17
86 0.19
87 0.26
88 0.34
89 0.41
90 0.51
91 0.61
92 0.66
93 0.7
94 0.76
95 0.78
96 0.78
97 0.73
98 0.67
99 0.59
100 0.51
101 0.46
102 0.37
103 0.29
104 0.21
105 0.19
106 0.15
107 0.14
108 0.14
109 0.11
110 0.11
111 0.09
112 0.09
113 0.12
114 0.12
115 0.1
116 0.15
117 0.19
118 0.21
119 0.28
120 0.3
121 0.28
122 0.33
123 0.32
124 0.29
125 0.26
126 0.23
127 0.16
128 0.15
129 0.14
130 0.08
131 0.07
132 0.06
133 0.05
134 0.04